close all open/close all

CDS information : Calm_00210


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction20,791 / 21,426 / + [in whole cluster]
20,791 / 21,426 / + [in contig]
Location20791..21426 [in whole cluster]
20791..21426 [in contig]
TypeCDS
Length636 bp (211 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)CalU9
Gene
Gene (GenBank)calU9
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)

close this sectionSequence

selected fasta
>hypothetical protein [CalU9]
MIIYTAASVHDLSIDADQLAGLTWSGHALWYADQGREQATCLDPRTGAPGHTLSCPGLVA
GLTSLGGHLLYATDGALRLCDTQTGDILRDVPSPRPGVPICGMEAGKDGIWLGWSDALEL
RHASDLRLLATVPAPLGVTGVTVTDRYVAHTDRLGEAITVFDLRAGRNVLQIHVDGRPTS
LTWDGLRLWYGDAANLRLRALDVPGLSATTA
selected fasta
>hypothetical protein [CalU9]
ATGATCATTTACACCGCGGCGTCGGTGCACGACCTCTCCATCGACGCGGACCAGCTCGCC
GGCCTCACCTGGTCCGGCCACGCACTCTGGTACGCCGACCAGGGCCGCGAGCAGGCCACC
TGCCTTGACCCGCGCACCGGCGCCCCCGGGCACACGCTGTCCTGCCCGGGCCTGGTGGCC
GGGCTCACCTCGCTCGGCGGGCACCTGCTCTACGCCACCGACGGGGCGCTGCGGCTCTGT
GACACGCAGACCGGCGACATCCTGCGGGACGTGCCGAGCCCGCGGCCGGGCGTGCCGATC
TGCGGGATGGAGGCGGGCAAGGACGGGATCTGGCTGGGCTGGTCCGACGCGTTGGAGCTC
CGGCACGCCTCGGACCTGCGGCTCCTGGCCACCGTGCCCGCCCCGCTCGGGGTCACCGGG
GTGACGGTGACCGACCGGTACGTCGCCCACACCGACCGGCTCGGCGAGGCGATCACCGTC
TTCGACCTGCGCGCCGGGCGGAACGTACTGCAGATCCACGTCGACGGCCGGCCCACCAGC
CTGACGTGGGACGGTCTGCGCCTGTGGTACGGCGACGCCGCCAACCTGCGCCTACGGGCG
CTGGACGTGCCGGGGCTGTCCGCGACGACCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011044 Quinoprotein amine dehydrogenase, beta chain-like (Domain)
 [6-204]  4.00000300869883e-15 SSF50969
SSF50969   Amine_DH_B_like
IPR015943 WD40/YVTN repeat-like-containing domain (Domain)
 [29-202]  2.80000000000001e-12 G3DSA:2.130.10.10
G3DSA:2.130.10.10   WD40/YVTN_repeat-like
SignalP No significant hit
TMHMM No significant hit