close all open/close all

CDS information : Calm_00240


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction26,896 / 24,503 / - [in whole cluster]
26,896 / 24,503 / - [in contig]
Locationcomplement(24503..26896) [in whole cluster]
complement(24503..26896) [in contig]
TypeCDS
Length2,394 bp (797 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative ATP-dependent Clp protease ATP-binding subunit ClpC
Product (GenBank)CalR4
GenecalR4
clpC
Gene (GenBank)calR4
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)
Related Reference
ACC
P37571
PmId
[8195092] Stress induction of clpC in Bacillus subtilis and its involvement in stress tolerance. (J Bacteriol. , 1994)
[9890793] Competence in Bacillus subtilis is controlled by regulated proteolysis of a transcription factor. (EMBO J. , 1998)

close this sectionSequence

selected fasta
>putative ATP-dependent Clp protease ATP-binding subunit ClpC [CalR4]
MRVRGVAAKALESLGISLEGVRQQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQL
GHNYIGTEHILLGLIREGEGVAAQVLVKLGADLNRVRQQVIQLLSGYQGKEPAAAGAAAG
EAAPSTSLVLDQFGRNLTQAAREGKLDPVIGREKEIERVMQVLSRRTKNNPVLIGEPGVG
KTAVVEGLSQKIIKGEVPETLKDKQLYTLDLGALVAGSRYRGDFEERLKKVLKEIRTRGD
IILFIDEIHTLVGAGAAEGAIDAASILKPMLARGELQTIGATTLDEYRKHLEKDAALERR
FQPIQVGEPSLAHTIEILKGLRDRYEAHHRVSITDAALVAAATLADRYISDRFLPDKAID
LIDEAGARMRIRRMTAPPDLRDFDERIAQVRRDKESAIDAQDFERAAQLRDKEKQLLGQK
AQREKEWKAGDLDVVSEVDDEQIAEVLGNWTGIPVYKLTEEETSRLLRMEDELHKRVIGQ
EDAVKAVSKAIRRTRAGLKDPKRPSGSFIFAGPSGVGKTELSKALAEFLFGSEDALIQLD
MSEFHDRYTVSRLVGAPPGYVGYDEGGQLTEKVRRRPFSVVLFDEIEKAHPDVFNTLLQI
LEDGRLTDGQGRIVDFKNTVIILTTNLGTRDVAKAVSLGFQASEDSESNYDRMKQKVNDE
LKQHFRPEFLNRIDDTIVFHQLRENEILSIVDIMIARIETQLRNKDMGLELTDNAKKYLA
KKGFDPVLGARPLRRTIQRDIEDNLSERILFNELTPGQIVVVDCEGDPSNTAKSKLVFRG
ADKPPTGPVPDAGAVTA
selected fasta
>putative ATP-dependent Clp protease ATP-binding subunit ClpC [CalR4]
ATGAGGGTGAGGGGTGTGGCTGCGAAGGCTCTGGAGAGTCTTGGTATCTCTCTGGAGGGT
GTGCGTCAGCAGGTCGAGGAGATCATCGGCCAGGGTCAGCAGGCGCCGAGCGGGCATATT
CCGTTCACGCCGCGGGCGAAGAAGGTGTTGGAGCTGTCGCTGCGTGAGGCGTTGCAGCTC
GGCCACAACTACATCGGTACGGAGCACATCCTGCTGGGTCTGATCCGTGAGGGTGAGGGT
GTCGCCGCCCAGGTGCTGGTGAAGCTGGGTGCGGACCTGAACCGGGTGCGGCAGCAGGTG
ATCCAGTTGCTGTCGGGTTACCAGGGCAAGGAGCCGGCTGCGGCGGGTGCTGCGGCGGGT
GAGGCCGCGCCGTCGACCAGCCTTGTGCTGGACCAGTTCGGTCGGAACCTGACCCAGGCC
GCCCGTGAGGGCAAGCTCGACCCGGTGATCGGGCGGGAGAAGGAAATCGAGCGGGTCATG
CAGGTGTTGTCCCGCCGGACGAAGAACAACCCGGTCCTGATCGGTGAGCCCGGTGTCGGT
AAGACCGCCGTGGTGGAGGGCCTGTCCCAGAAGATCATCAAGGGCGAGGTGCCCGAGACG
CTGAAGGACAAGCAGCTCTACACCCTCGACCTGGGTGCGCTGGTGGCTGGTTCCCGCTAC
CGGGGTGACTTCGAGGAGCGCTTGAAGAAGGTGCTCAAGGAGATCCGCACGCGGGGCGAC
ATCATCCTGTTCATCGACGAGATCCACACCCTCGTCGGGGCTGGGGCGGCGGAGGGCGCG
ATCGACGCGGCGTCGATTCTGAAGCCGATGCTGGCTCGTGGTGAGTTGCAGACCATCGGT
GCGACGACGCTGGACGAGTACCGCAAGCACTTGGAGAAGGACGCCGCTCTTGAGCGTCGT
TTCCAGCCGATTCAGGTGGGTGAGCCGTCGCTGGCGCACACCATCGAGATCCTCAAGGGG
CTGCGGGACCGGTACGAGGCGCACCACCGGGTGAGCATCACCGACGCCGCCCTGGTGGCG
GCGGCGACGCTGGCGGACCGGTACATCTCCGATCGGTTCCTGCCGGACAAGGCGATCGAC
CTGATCGACGAGGCGGGTGCGCGGATGCGGATCCGTCGGATGACCGCGCCGCCGGACCTG
CGTGACTTCGATGAGCGCATCGCGCAGGTGCGCCGTGACAAGGAGTCCGCGATCGACGCG
CAGGACTTCGAGCGGGCCGCGCAGCTGCGGGACAAGGAGAAGCAGCTGCTGGGTCAGAAG
GCGCAGCGGGAGAAGGAGTGGAAGGCCGGCGACCTGGACGTCGTCAGTGAGGTCGACGAC
GAGCAGATCGCTGAGGTGCTGGGTAACTGGACCGGCATCCCGGTGTACAAGTTGACCGAG
GAGGAGACCTCGCGTCTGCTGCGCATGGAGGACGAGCTGCACAAGCGCGTCATCGGGCAG
GAGGACGCGGTCAAGGCCGTCTCGAAGGCGATCCGCCGTACCCGCGCGGGGTTGAAGGAC
CCGAAGCGCCCGTCGGGGTCGTTCATCTTCGCCGGCCCGTCCGGTGTCGGTAAGACCGAG
CTGTCCAAGGCCCTGGCGGAGTTCCTGTTCGGGTCCGAGGACGCGCTGATCCAGCTGGAC
ATGTCGGAGTTCCACGACCGGTACACGGTGTCGCGGCTGGTGGGTGCCCCTCCCGGCTAC
GTCGGCTACGACGAGGGCGGTCAGCTGACGGAGAAGGTGCGGCGTCGGCCGTTCTCGGTG
GTCCTGTTCGACGAGATCGAGAAGGCCCACCCGGACGTGTTCAACACGCTGCTCCAGATC
CTGGAGGACGGTCGGCTCACCGATGGTCAGGGTCGGATCGTGGACTTCAAGAACACGGTC
ATCATCCTGACCACGAACCTGGGTACCCGTGACGTGGCGAAGGCCGTGTCGCTGGGCTTC
CAGGCGTCGGAGGACTCGGAGTCGAACTACGACCGGATGAAGCAGAAGGTCAACGACGAG
TTGAAGCAGCACTTCCGGCCGGAGTTCCTGAACCGTATCGATGACACGATCGTGTTCCAC
CAGCTGCGCGAGAACGAGATCCTGTCGATCGTGGACATCATGATCGCTCGGATCGAGACG
CAGCTGCGGAACAAGGACATGGGTCTGGAGCTGACCGACAACGCCAAGAAGTACCTGGCG
AAGAAGGGCTTCGACCCCGTGCTCGGCGCGCGGCCGCTGCGCCGCACGATCCAGCGCGAC
ATCGAGGACAACCTGTCCGAGCGGATCCTGTTCAACGAACTGACCCCCGGCCAGATCGTC
GTCGTCGACTGCGAAGGCGACCCCAGCAACACCGCCAAGTCCAAGCTCGTGTTCCGGGGA
GCCGACAAGCCGCCGACAGGGCCGGTCCCCGACGCCGGGGCGGTGACGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001270 Chaperonin ClpA/B (Family)
 [508-526]  7.6999848053369e-41 PR00300 [553-571]  7.6999848053369e-41 PR00300 [582-600]  7.6999848053369e-41 PR00300 [615-629]  7.6999848053369e-41 PR00300
PR00300   CLPPROTEASEA
IPR001943 UVR domain (Domain)
 [384-419]  PS50151
PS50151   UVR
 [384-416]  2.5e-08 PF02151
PF02151   UVR
IPR003593 AAA+ ATPase domain (Domain)
 [167-311]  7.49999605851445e-12 SM00382 [504-684]  3.89999861795218e-12 SM00382
SM00382   AAA
IPR003959 ATPase, AAA-type, core (Domain)
 [172-288]  2.2e-12 PF00004
PF00004   AAA
IPR004176 Clp, N-terminal (Domain)
 [5-30]  0.016 PF02861 [54-104]  4.00000000000001e-18 PF02861
PF02861   Clp_N
IPR013093 ATPase, AAA-2 (Domain)
 [503-675]  6.29999999999998e-52 PF07724
PF07724   AAA_2
IPR018368 Chaperonin ClpA/B, conserved site (Conserved_site)
 [262-274]  PS00870
PS00870   CLPAB_1
IPR019489 Clp ATPase, C-terminal (Domain)
 [682-762]  5.30000000000001e-25 PF10431
PF10431   ClpB_D2-small
 [682-778]  1.3000049540733e-36 SM01086
SM01086   ClpB_D2-small
IPR023150 Double Clp-N motif (Domain)
 [4-103]  2.7e-32 G3DSA:1.10.1780.10
G3DSA:1.10.1780.10   Dbl_Clp-N
SignalP No significant hit
TMHMM No significant hit