close all open/close all

CDS information : Calm_00300


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction34,553 / 33,669 / - [in whole cluster]
34,553 / 33,669 / - [in contig]
Locationcomplement(33669..34553) [in whole cluster]
complement(33669..34553) [in contig]
TypeCDS
Length885 bp (294 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative methyltransferase
Product (GenBank)CalE5
Gene
Gene (GenBank)calE5
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)
Family/Domain
FD
IPR013216

close this sectionSequence

selected fasta
>putative methyltransferase [CalE5]
MAFKAEQRDTWNAVSAGWDYWQDRYERAAAPVTDWLLRAAGLRPGHRVLDVGCGTGEPSV
SAGRLVAPTGRVLGIDLSPEMVDRARRCAAGLGHPIDFAESDVEALDLPAHSFDAVLSRW
GLMFAVDRQRTLTDLHRLLAPGGVLAAAVWGPPEANPMTALGFRTLAAGLPVPPPGRPGP
FSMSDAGRVRADLLAAGFTDVGTESVGYTRDVTPPGVLATVRRQLGADAERAGWDRLAEA
AAAFADADGLLTLPGSALCLRARRPADTSAAPADGGRPEAAGSGPPGAGPGRAG
selected fasta
>putative methyltransferase [CalE5]
GTGGCCTTCAAGGCCGAGCAACGTGACACCTGGAACGCGGTCAGCGCCGGGTGGGACTAC
TGGCAGGACCGCTACGAGCGGGCCGCGGCGCCGGTGACCGACTGGCTGCTGCGCGCCGCC
GGGCTCCGCCCCGGTCACCGGGTGCTCGACGTCGGCTGCGGCACCGGCGAGCCGTCGGTC
AGCGCCGGCCGGCTGGTCGCCCCGACCGGCCGGGTGCTCGGCATCGACCTCTCCCCGGAG
ATGGTCGACCGGGCCCGCCGCTGCGCCGCCGGCCTCGGCCACCCCATCGACTTCGCCGAG
TCCGACGTGGAGGCCCTCGATTTGCCGGCGCACTCCTTCGACGCGGTGCTCAGCCGGTGG
GGGCTGATGTTCGCGGTGGACCGCCAGCGCACCCTCACGGACCTGCACCGCCTCCTGGCG
CCCGGCGGCGTGCTGGCCGCCGCCGTCTGGGGGCCGCCGGAGGCGAACCCGATGACCGCG
CTGGGCTTCCGGACGCTGGCCGCGGGCCTGCCGGTCCCCCCGCCGGGCCGCCCCGGCCCG
TTCAGCATGTCCGACGCCGGCCGCGTCCGCGCCGACCTGCTCGCCGCCGGCTTCACGGAC
GTCGGCACCGAGTCCGTCGGGTACACCCGGGACGTGACGCCGCCCGGTGTCCTCGCCACG
GTGCGGCGGCAGCTCGGCGCCGACGCGGAGCGGGCGGGCTGGGACCGGCTCGCCGAGGCC
GCCGCCGCCTTCGCCGACGCGGACGGCCTGCTCACCCTGCCCGGCTCGGCGCTCTGCCTG
CGCGCGCGCCGGCCCGCCGACACCTCCGCGGCGCCGGCCGACGGTGGCCGACCCGAGGCG
GCCGGATCCGGCCCGCCGGGGGCCGGGCCGGGGAGGGCCGGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013216 Methyltransferase type 11 (Domain)
 [49-146]  2.3e-19 PF08241
PF08241   Methyltransf_11
SignalP No significant hit
TMHMM No significant hit