close all open/close all

CDS information : Calm_00310


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction35,580 / 34,687 / - [in whole cluster]
35,580 / 34,687 / - [in contig]
Locationcomplement(34687..35580) [in whole cluster]
complement(34687..35580) [in contig]
TypeCDS
Length894 bp (297 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productglucose-1-phosphate nucleotidyltransferase
Product (GenBank)CalS7
Gene
Gene (GenBank)calS7
EC number2.7.7.-
Keyword
  • aminodideoxypentose
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)
[18807197] Cloning and characterization of CalS7 from Micromonospora echinospora sp. calichensis as a glucose-1-phosphate nucleotidyltransferase. (Biotechnol Lett. , 2009)

close this sectionSequence

selected fasta
>glucose-1-phosphate nucleotidyltransferase [CalS7]
MRGVLLAGGTGSRMWPVTRAVSKQLMPVYDKPMIFYPLSTLVTAGVREILIITRPDEQPL
FRRLLGDGGQWGLDLRYAVQERPDGIAHALLLAADFLAGGPAVLILGDNIIHSAGLDRQL
AELTEVDGGLVFGLPVADPRPYGVLDFDECGAVRDIVEKPLVPPSRYAVPGLYVYGADVV
SIAAELTPSARGELEITDVNREYLRRGRLEVRLLGRRTAWLDTGRFGDLMKAAEYVRVIE
ERHGVKVGCVEEAAWRAGLLDDAAMRRLAVPLRASGYGDYLLRLLDGERPARPAAVG
selected fasta
>glucose-1-phosphate nucleotidyltransferase [CalS7]
ATGCGTGGTGTTTTGCTCGCTGGTGGCACCGGGTCGCGGATGTGGCCGGTGACCCGGGCG
GTCTCCAAGCAACTGATGCCGGTCTACGACAAGCCGATGATCTTCTATCCGCTGAGCACC
CTCGTGACGGCCGGTGTGCGGGAGATCCTCATCATCACGCGCCCCGACGAGCAGCCGCTG
TTCCGGCGCCTGCTCGGCGACGGTGGCCAGTGGGGGCTCGACCTGCGGTACGCCGTGCAG
GAGCGCCCGGACGGCATCGCCCACGCGCTCCTGCTCGCCGCGGACTTCCTCGCCGGCGGC
CCGGCCGTGCTCATCCTCGGCGACAACATCATTCACTCCGCCGGGCTGGACCGGCAGCTC
GCGGAGCTGACCGAGGTGGACGGTGGGCTGGTCTTCGGGCTCCCGGTGGCGGACCCTCGG
CCGTACGGGGTGCTCGACTTCGACGAGTGCGGCGCGGTGCGCGACATCGTGGAGAAGCCC
CTGGTCCCGCCGTCCCGGTACGCCGTGCCCGGCCTCTACGTGTACGGCGCGGACGTCGTC
TCCATCGCCGCCGAACTGACGCCCAGCGCCCGGGGCGAGTTGGAGATCACCGACGTCAAC
CGGGAGTACCTGCGCCGGGGCCGGCTGGAGGTGCGGCTGCTCGGGCGGCGCACCGCGTGG
CTGGACACCGGCCGGTTCGGCGACCTGATGAAGGCGGCCGAGTACGTGCGCGTGATCGAG
GAGCGGCACGGAGTCAAGGTCGGCTGCGTCGAGGAGGCGGCCTGGCGGGCCGGGCTGCTC
GACGACGCGGCGATGCGCCGCCTGGCGGTGCCGCTGCGCGCCAGCGGGTACGGCGACTAC
CTGCTGCGCCTGCTCGACGGCGAGCGCCCGGCGCGCCCGGCCGCCGTCGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005835 Nucleotidyl transferase (Domain)
 [3-235]  8.00000000000001e-56 PF00483
PF00483   NTP_transferase
IPR005907 Glucose-1-phosphate thymidylyltransferase, short form (Family)
 [2-285]  1.29999999999998e-112 TIGR01207
TIGR01207   RmlA
SignalP No significant hit
TMHMM No significant hit