close all open/close all

CDS information : Calm_00320


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction35,749 / 36,411 / + [in whole cluster]
35,749 / 36,411 / + [in contig]
Location35749..36411 [in whole cluster]
35749..36411 [in contig]
TypeCDS
Length663 bp (220 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)CalU12
Gene
Gene (GenBank)calU12
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)

close this sectionSequence

selected fasta
>hypothetical protein [CalU12]
MAARRALASAEQDLRDQLERVAAARRRLPPGPLLADYRLAEGPADLTRSGPARSVRLRDL
FEEHETLFVYHLMFAPEAAEACPMCSLWVDGFHGVLPHLRRHTAVAVVAKAPLPRLRAWA
RRRGWAGLRILSSHGTSFNADLRAEHPDGTQRPMVSVLRAEGDRVRHFYSAPASFPDGGE
RGIDLLSPVWNVLDLLPEGRRDWYAGNDYVPAPAASPEPV
selected fasta
>hypothetical protein [CalU12]
GTGGCCGCGCGGCGGGCGCTCGCGTCGGCCGAGCAGGACCTGCGGGACCAGCTCGAACGC
GTGGCCGCGGCGCGGCGGCGGCTGCCACCCGGCCCGCTGCTGGCCGACTACCGGCTCGCC
GAGGGGCCGGCCGACCTGACCCGCTCCGGGCCGGCCCGGAGCGTCCGGCTGCGCGACCTG
TTCGAGGAGCACGAGACCCTCTTCGTCTACCACCTGATGTTCGCACCGGAGGCCGCCGAG
GCATGTCCCATGTGCTCGCTGTGGGTGGACGGCTTCCACGGGGTGCTTCCGCACCTGCGT
CGGCACACCGCCGTGGCGGTGGTGGCGAAGGCCCCGCTGCCGCGGCTGCGTGCCTGGGCC
CGGCGGCGGGGCTGGGCCGGCCTGCGGATCCTGTCCAGCCACGGCACGTCCTTCAACGCC
GACCTGCGCGCCGAACACCCGGACGGCACCCAACGACCGATGGTCAGCGTGCTGCGCGCC
GAGGGCGACCGGGTGAGGCACTTCTACTCCGCCCCGGCGAGCTTCCCCGACGGTGGCGAG
CGCGGCATCGACCTGCTCAGCCCGGTCTGGAACGTCCTCGACCTGCTGCCTGAGGGCCGC
CGCGACTGGTACGCCGGCAACGACTACGTCCCCGCCCCGGCGGCCTCCCCCGAACCGGTC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR010296 Protein of unknown function DUF899, thioredoxin-like (Family)
 [2-202]  1.70000000000001e-51 PF05988
PF05988   DUF899
SignalP No significant hit
TMHMM No significant hit