close all open/close all

CDS information : Calm_00340


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction38,313 / 37,168 / - [in whole cluster]
38,313 / 37,168 / - [in contig]
Locationcomplement(37168..38313) [in whole cluster]
complement(37168..38313) [in contig]
TypeCDS
Length1,146 bp (381 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productmethionine gamma-lyase
Product (GenBank)CalE6
Gene
Gene (GenBank)calE6
EC number4.4.1.11
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)
[25404066] Identification and characterization of a methionine gamma-lyase in the calicheamicin biosynthetic cluster of Micromonospora echinospora. (Chembiochem. , 2015)
Related Reference
ACC
A2RM21
PmId
[10618201] Molecular and functional analyses of the metC gene of Lactococcus lactis, encoding cystathionine beta-lyase. (Appl Environ Microbiol. , 2000)
[10620674] Identification and characterization of a cystathionine beta/gamma-lyase from Lactococcus lactis ssp. cremoris MG1363. (FEMS Microbiol Lett. , 2000)

close this sectionSequence

selected fasta
>methionine gamma-lyase [CalE6]
MSGMRFDTRLVHGGRRPSAGTGDVVPPIHVSTTYERRAQDEPRYFYGRGENPTREELEEC
LAGLERAPFATVFSSGQAAAATLLSLVRPGQCVVSTDDVYAGTDGLFDLAARQGVRVRYA
DLTTPEGIAAALAEPDLALVWIETPTNPLLTVVDVAEVSRRAHERGARVVVDNTFASPVL
QQPLALGADVSLYSTTKSIAGHADVLGGALVYRDADLHAAVRAYRTTAGNVPGALDCFLV
RRGLHTLSLRVHRQVATARVLVERLRASPVVGAVHYPGLPEHPQHAVVKAQMSAPGAIVS
FDYLGGPAERLLDRFTLFTCGVSLGGVHSLVECPALMTHRPLSAEARARRGIGESLIRLS
VGIEDPQDLAEDLSRALAGGT
selected fasta
>methionine gamma-lyase [CalE6]
GTGAGCGGTATGCGCTTCGACACCCGGCTGGTGCACGGCGGCCGCCGGCCGTCGGCCGGC
ACCGGGGACGTCGTCCCCCCGATCCACGTCTCCACCACCTACGAGCGCCGCGCGCAGGAC
GAGCCCCGCTACTTCTACGGCCGGGGCGAGAACCCCACCCGGGAGGAGCTGGAGGAGTGC
CTCGCCGGTCTGGAGCGGGCGCCGTTCGCCACGGTCTTCTCCTCCGGGCAGGCCGCCGCC
GCGACCCTGCTGTCGCTGGTGCGGCCCGGGCAGTGCGTGGTGAGCACCGACGACGTGTAC
GCCGGCACCGACGGCCTGTTCGACCTGGCCGCGCGGCAGGGCGTGCGGGTGCGGTACGCC
GACCTGACCACGCCGGAGGGGATCGCGGCGGCCCTGGCCGAGCCGGACCTGGCCCTGGTC
TGGATCGAGACGCCGACCAACCCGCTGCTCACCGTGGTGGACGTCGCCGAGGTCAGCCGG
CGGGCGCACGAGCGGGGGGCCCGCGTGGTGGTCGACAACACCTTCGCCAGCCCGGTGCTC
CAGCAGCCGCTGGCGCTCGGCGCCGACGTCTCGCTGTACAGCACCACCAAGTCCATCGCC
GGCCACGCGGACGTGCTGGGCGGTGCCCTCGTCTACCGCGACGCGGACCTGCACGCCGCG
GTCCGGGCGTACCGGACGACGGCCGGGAACGTGCCGGGGGCGCTGGACTGCTTCCTGGTC
CGCCGGGGGCTGCACACCCTGTCGCTGCGGGTGCACCGGCAGGTCGCCACCGCGCGCGTC
CTGGTGGAGCGGCTGCGGGCGAGCCCCGTGGTCGGCGCCGTCCACTATCCGGGGCTGCCC
GAGCACCCCCAGCACGCGGTCGTCAAGGCCCAGATGAGCGCGCCCGGCGCGATCGTCTCC
TTCGACTACCTCGGCGGCCCCGCCGAGCGACTGCTGGACCGGTTCACGCTCTTCACCTGC
GGCGTCAGCCTCGGGGGCGTGCACTCCCTTGTGGAGTGCCCGGCCCTGATGACGCACCGT
CCGCTGTCGGCCGAGGCGCGCGCGCGTCGGGGCATCGGCGAGTCGCTGATCCGGTTGTCG
GTCGGCATCGAGGACCCGCAGGACCTCGCCGAGGACCTGTCCCGGGCGCTGGCGGGCGGC
ACCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000277 Cys/Met metabolism, pyridoxal phosphate-dependent enzyme (Family)
 [7-381]  PIRSF001434
PIRSF001434   CGS
 [7-377]  1.9e-116 PF01053
PF01053   Cys_Met_Meta_PP
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [6-246]  1.39999999999997e-78 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [247-378]  1.80000000000002e-42 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [10-378]  3.39999972437719e-99 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP No significant hit
TMHMM No significant hit