close all open/close all

CDS information : Calm_00350


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction38,756 / 38,310 / - [in whole cluster]
38,756 / 38,310 / - [in contig]
Locationcomplement(38310..38756) [in whole cluster]
complement(38310..38756) [in contig]
TypeCDS
Length447 bp (148 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative thioesterase
Product (GenBank)CalE7
Gene
Gene (GenBank)calE7
EC number
Keyword
  • TEBC family
  • enediyne core
Note
  • Similar to Hotdog-fold thioesterase.
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)
[18529057] Characterization of a carbonyl-conjugated polyene precursor in 10-membered enediyne biosynthesis. (J Am Chem Soc. , 2008)
[19357082] Structure and catalytic mechanism of the thioesterase CalE7 in enediyne biosynthesis. (J Biol Chem. , 2009)
[12536216] A genomics-guided approach for discovering and expressing cryptic metabolic pathways. (Nat Biotechnol. , 2003)
Related Reference
ACC
Q84HI7
NITE
Dynm_00190
PmId
[20888341] Induced-fit upon ligand binding revealed by crystal structures of the hot-dog fold thioesterase in dynemicin biosynthesis. (J Mol Biol. , 2010)

close this sectionSequence

selected fasta
>putative thioesterase [CalE7]
MSMPRYYEYRHVVGFEETNLVGNVYYVNYLRWQGRCREMFLYEHAPEILDELRADLKLFT
LKAECEFFAELAPFDRLAVRMRLVELTQTQMELGFDYLRLGGDDLLVARGRQRIACMRGP
NGRTEPVRVPAGLVRAFAPFRSATVGQG
selected fasta
>putative thioesterase [CalE7]
GTGAGCATGCCGCGCTACTACGAGTACCGGCACGTCGTCGGCTTCGAGGAGACCAACCTC
GTCGGCAACGTGTACTACGTCAACTACCTGCGCTGGCAGGGCCGGTGCCGGGAGATGTTC
CTGTACGAGCACGCGCCGGAGATCCTCGACGAGCTGCGCGCCGACCTGAAGCTGTTCACC
CTCAAGGCCGAGTGCGAGTTCTTCGCCGAGCTGGCGCCGTTCGACCGCCTCGCGGTCCGG
ATGCGGCTGGTCGAACTCACCCAGACCCAGATGGAGCTGGGCTTCGACTACCTGCGGCTC
GGCGGCGACGATCTGCTGGTCGCCCGGGGGCGGCAGCGGATCGCGTGCATGCGCGGGCCG
AACGGGCGGACCGAGCCGGTCCGGGTGCCGGCCGGCCTGGTGCGGGCGTTCGCCCCGTTC
CGGTCGGCCACGGTGGGGCAGGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit