close all open/close all

CDS information : Calm_00360


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction44,512 / 38,753 / - [in whole cluster]
44,512 / 38,753 / - [in contig]
Locationcomplement(38753..44512) [in whole cluster]
complement(38753..44512) [in contig]
TypeCDS
Length5,760 bp (1,919 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)CalE8
Gene
Gene (GenBank)calE8
EC number
Keyword
  • iterative
  • enediyne core
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)
[18529057] Characterization of a carbonyl-conjugated polyene precursor in 10-membered enediyne biosynthesis. (J Am Chem Soc. , 2008)
[18319060] Evidence for a novel phosphopantetheinyl transferase domain in the polyketide synthase for enediyne biosynthesis. (FEBS Lett. , 2008)
[19689130] Production of octaketide polyenes by the calicheamicin polyketide synthase CalE8: implications for the biosynthesis of enediyne core structures. (J Am Chem Soc. , 2009)
[21674045] Solution structures of the acyl carrier protein domain from the highly reducing type I iterative polyketide synthase CalE8. (PLoS One. , 2011)
[23009853] Rigidifying acyl carrier protein domain in iterative type I PKS CalE8 does not affect its function. (Biophys J. , 2012)
[12536216] A genomics-guided approach for discovering and expressing cryptic metabolic pathways. (Nat Biotechnol. , 2003)
[23042574] Environmental control of the calicheamicin polyketide synthase leads to detection of a programmed octaketide and a proposal for enediyne biosynthesis. (Angew Chem Int Ed Engl. , 2012)
[24041368] Biochemical determination of enzyme-bound metabolites: preferential accumulation of a programmed octaketide on the enediyne polyketide synthase CalE8. (J Am Chem Soc. , 2013)
[25019332] Enediyne polyketide synthases stereoselectively reduce the beta-ketoacyl intermediates to beta-D-hydroxyacyl intermediates in enediyne core biosynthesis. (Org Lett. , 2014)
Related Reference
ACC
Q8GME1
NITE
C1027_00520
PmId
[12183628] Biosynthesis of the enediyne antitumor antibiotic C-1027. (Science. , 2002)
[12536216] A genomics-guided approach for discovering and expressing cryptic metabolic pathways. (Nat Biotechnol. , 2003)
[14528002] Rapid PCR amplification of minimal enediyne polyketide synthase cassettes leads to a predictive familial classification model. (Proc Natl Acad Sci U S A. , 2003)
[18223152] A phosphopantetheinylating polyketide synthase producing a linear polyene to initiate enediyne antitumor antibiotic biosynthesis. (Proc Natl Acad Sci U S A. , 2008)
[25019332] Enediyne polyketide synthases stereoselectively reduce the beta-ketoacyl intermediates to beta-D-hydroxyacyl intermediates in enediyne core biosynthesis. (Org Lett. , 2014)
ACC
Q84HI8
NITE
Dynm_00180
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)
[22589546] Crystal structure of the acyltransferase domain of the iterative polyketide synthase in enediyne biosynthesis. (J Biol Chem. , 2012)
[12536216] A genomics-guided approach for discovering and expressing cryptic metabolic pathways. (Nat Biotechnol. , 2003)
[25019332] Enediyne polyketide synthases stereoselectively reduce the beta-ketoacyl intermediates to beta-D-hydroxyacyl intermediates in enediyne core biosynthesis. (Org Lett. , 2014)

close this sectionPKS/NRPS Module

A1 acetyl-CoA
malonyl-CoA
KS2..411
AT621..839
ACP925..1017
KR1200..1380
DH1450..1606
PPT1708..1912

close this sectionSequence

selected fasta
>polyketide synthase [CalE8]
MSRIAVVGLACRFPDAAGPGQLWENALAGRRAFRRLPEERMRAADYWSPDPAAPDRYYAG
NAAVIEGYEFDRVGFKVSGSTYRSTDLTHWLALDMAAQALADAGFPEGDGLPRERTAVVV
GNTLTGEFTRAGMMRLRWPYVRRVVGAALGEQGWDDDRVAAFLADLERSYKAPFAEITED
SLAGGLSNTIAGRICNHFDLHGGGYTVDGACASSLLSVVTACRSLTDLDVDVAVAGGVDL
SIDPFEMVGFAKTGALAGDEMRVYDRRSNGFWPGEGCGMVVLMRERDALAQGRRIYASVA
GWGVSSDGRGGITRPEAAGYRLALRRAYQRAGFGVDTVPLFEGHGTGTAVGDGTELRALG
EERRAADPDADPAAIGSIKGMIGHTKAAAGVAGLIKAVLAVHHQVVPPTVGCVEPHPELA
ADRPALRAVRRAEPWPAGAAQRAGVTAMGFGGINTHLVVDGPTRPRRRSLDRRTQQLARS
VQDAELLLVDADTRDELRDRLDDLRTVVAGLAFAELGDLATNLHRSQRGRAYRAAVVARS
PEEADRALGLAARALAPEGAGTLVDPARGVFVGRVTRPARVGFLFPGQGSGRGWGGGALR
RRFTEIDDVYRAAGEPPGDEAAGSTVFAQPRIVTGSLAGLRALAALDIDATVVVGHSLGE
LTTLHWAGCLDEDELRELVTLRGEAMARHAPPGAMLGVTAGPEETVALLAGTNAVIAGYN
GPRQTVVAGADDIVAEVARRAATAGVNCTRLPVPHAFHSPLMASAAAAFAERLRSRRFGP
LLRRVASTVTGAVLPSDTDLPRHLHRQIEAPVRFAAALGRAAAEVDLFLEVGPGRVLTGL
AREQAPDVPALAVDTDAESLSGLLAAVGAVYALGGPAAYPVLFEDRLTRPFDPHRARTFF
ASPCEAAPELAGPAPAAVAPVPAPARADDTALPAATGALELVRHLVAERAELPVEVLRDD
SRFLDDLHMSSITVGQLVNEAARAMGLSAVAMPTNFATATVREMAEALEAREREAPHERA
DLVAGVAPWVRTFVVDLVDEPLPATDPTEPCGRWQVFAGADHPLADALRRALEAAGVGEG
VLVCLPDEPDEEHLVTAVRGAQAALRQPPGGRLVVVQPAARAGALAKTARLEGDRLRTTV
VTTPLDPAAVDRVVADVAATDDFTEAVYDPGGRRRVPVLRPLPASDGEPGALPLGPADVL
LVTGGGKGITAESALMLARESGARLAVLGRSDPTADEALADNLKRLADAASDLRYLRVDV
TDAGAVAAAVATVTADWGPVTAVLHGAGQNTPAALADLDEAALRGVFAAKVDGLRAVLAA
VDPARLRLLVTFGSIIGRAGLHGEAHYAAANEALAELTREVAATRPECRAVCLEWSVWSG
VGMGERLSVVESLSGSGVTPISPDDGLRVLREVVADDTLPPVVVVTGRTGGVETLRYHRS
ELPLLRFTERPLVRYDGIELVCEVDLARTTDPYLEDHRLDGDLLFPAVLGLEAMAQVATA
LARHPGVPVIEEVRFDRPVVVDPDTGTTVRVAALVRSEQVIDVVLRSAVTGFAADHFRAR
LRFAPDETYPAYTAAPAPAELPAVPLDPARDLYGDVLFQAGRFRRIKGYRQVAARVAEAE
VVTSDAASWFSAFLPGRLVLGDPGARDAFMHGIQVCVPDATLLPEGIDRIWSAGPKLSAT
EAVTMTAREREQHGTAYVYDVVVRDATGAVIEHWMGLRLRAVRPHAPRGSWPPALLGPLL
QRRLAEVFPGDIAVAAAPGGGPRDSGALLSRALGQPVVVRHRPDGRPEVDLPYTVSVAHS
APLDLAVAGDGTLACDAEPVAARPADVRRDLVGRHGAVAALLVAEVGDPPDVAATRVWCA
EECLQKAGRPEGRLTLLPGALPDGWVVLDAGDVRVATRVVAVAGAAAPAVVAVLSGAGR
selected fasta
>polyketide synthase [CalE8]
ATGAGCAGGATCGCCGTCGTCGGCCTGGCCTGCCGCTTCCCGGACGCCGCCGGCCCCGGG
CAGCTGTGGGAGAACGCCCTCGCCGGGCGGCGTGCGTTCCGCCGCCTGCCCGAGGAGCGG
ATGCGGGCCGCCGACTACTGGTCCCCGGATCCGGCCGCCCCCGACCGCTACTACGCGGGC
AACGCGGCCGTCATCGAGGGCTACGAGTTCGACCGGGTCGGGTTCAAGGTCAGCGGGAGC
ACGTACCGGTCCACCGACCTCACCCACTGGCTGGCCCTCGACATGGCCGCGCAGGCGCTC
GCCGACGCCGGGTTCCCCGAGGGCGACGGGCTGCCGCGGGAACGGACGGCGGTGGTCGTC
GGCAACACCCTCACCGGCGAGTTCACCCGGGCCGGCATGATGCGCCTGCGGTGGCCGTAC
GTCCGGCGCGTGGTGGGCGCCGCCCTCGGCGAGCAGGGCTGGGACGACGACCGGGTGGCG
GCCTTCCTCGCCGACCTGGAACGCTCCTACAAGGCGCCGTTCGCCGAGATCACCGAGGAC
AGCCTCGCGGGCGGCCTGTCCAACACCATCGCCGGGCGGATCTGCAACCACTTCGACCTG
CACGGCGGCGGGTACACGGTGGACGGCGCCTGCGCCTCCTCCCTGCTGTCGGTGGTCACC
GCCTGCCGCAGCCTGACCGACCTCGACGTCGACGTGGCGGTGGCCGGCGGCGTGGACCTG
TCCATCGACCCCTTCGAGATGGTCGGCTTCGCCAAGACCGGCGCGCTAGCCGGCGACGAG
ATGCGGGTCTACGACCGCCGCTCCAACGGGTTCTGGCCCGGCGAGGGCTGCGGCATGGTG
GTGCTCATGCGGGAGCGGGACGCGCTCGCGCAGGGCCGGCGCATCTACGCCTCGGTCGCC
GGGTGGGGCGTCTCCTCCGACGGTCGGGGCGGCATCACCCGGCCGGAGGCGGCCGGCTAC
CGGCTGGCCCTGCGGCGCGCGTACCAGCGGGCCGGTTTCGGGGTGGACACCGTGCCGCTG
TTCGAGGGGCACGGCACCGGCACGGCCGTCGGCGACGGCACCGAGCTGCGGGCCCTGGGC
GAGGAACGCCGGGCGGCCGACCCGGACGCGGACCCCGCCGCGATCGGATCCATCAAGGGG
ATGATCGGGCACACCAAGGCCGCGGCCGGGGTGGCCGGCCTGATCAAGGCCGTCCTGGCC
GTGCACCACCAGGTCGTCCCGCCGACCGTCGGGTGCGTCGAGCCGCACCCCGAACTCGCC
GCGGACCGGCCCGCGCTGCGCGCCGTACGGCGGGCCGAGCCGTGGCCGGCCGGCGCCGCG
CAGCGGGCCGGCGTCACCGCGATGGGCTTCGGCGGCATCAACACCCACCTCGTCGTCGAC
GGCCCCACCCGCCCCCGCCGCCGGTCCCTGGACCGGCGGACGCAGCAGCTCGCCCGGTCC
GTGCAGGACGCCGAGCTGCTCCTGGTCGACGCGGACACCCGCGACGAGCTGCGCGACCGG
CTGGACGACCTGCGGACGGTCGTGGCCGGGCTGGCCTTCGCCGAGCTGGGCGACCTCGCC
ACGAACCTGCACCGGAGCCAGCGCGGCCGCGCGTACCGGGCGGCGGTCGTGGCCCGGTCA
CCGGAGGAGGCCGACCGCGCCCTCGGACTGGCGGCCCGGGCCCTGGCGCCCGAGGGCGCC
GGGACACTGGTCGACCCGGCGCGGGGCGTCTTCGTCGGCCGGGTCACCCGGCCGGCCCGG
GTCGGCTTCCTGTTCCCCGGGCAGGGGTCCGGTCGGGGCTGGGGCGGCGGGGCGCTGCGC
CGGCGGTTCACCGAAATCGACGACGTCTACCGCGCGGCCGGGGAGCCACCCGGGGACGAG
GCGGCCGGGTCGACCGTGTTCGCCCAGCCCCGGATCGTCACGGGCTCGCTGGCCGGGCTG
CGCGCCCTCGCCGCGCTCGACATCGACGCGACCGTCGTCGTCGGGCACAGCCTCGGCGAA
CTCACCACGCTGCACTGGGCGGGCTGCCTCGACGAGGACGAGCTGCGGGAGCTCGTCACG
CTCCGGGGCGAGGCCATGGCCAGGCACGCCCCGCCCGGGGCGATGCTCGGCGTCACCGCC
GGGCCGGAGGAGACCGTCGCCCTGCTGGCCGGCACCAACGCGGTGATCGCCGGCTACAAC
GGGCCCCGGCAGACGGTCGTCGCCGGAGCCGACGACATCGTGGCCGAGGTGGCCCGCCGG
GCCGCGACGGCGGGGGTGAACTGCACCCGGCTGCCGGTCCCGCACGCCTTCCACTCGCCG
CTGATGGCATCGGCGGCCGCCGCCTTCGCCGAGCGCCTGCGGTCCCGCCGGTTCGGGCCG
CTGCTGCGCCGCGTGGCCTCGACGGTGACCGGCGCCGTCCTCCCGTCGGACACCGACCTG
CCGCGGCACCTGCACCGGCAGATCGAGGCTCCGGTGCGCTTCGCCGCCGCGCTGGGACGC
GCCGCCGCCGAGGTCGACCTGTTCCTCGAGGTCGGCCCCGGCAGGGTGCTCACCGGGCTG
GCCCGCGAGCAGGCGCCGGACGTGCCGGCGCTGGCGGTCGACACCGACGCCGAGTCGCTG
TCGGGCCTGCTCGCCGCGGTCGGCGCGGTGTACGCGCTCGGCGGCCCGGCCGCGTACCCG
GTCCTGTTCGAGGACCGGCTGACCCGACCGTTCGACCCGCACCGCGCCCGCACCTTCTTC
GCGAGCCCGTGCGAGGCGGCGCCCGAGCTGGCCGGGCCGGCACCGGCCGCGGTCGCCCCG
GTCCCGGCTCCGGCCCGGGCCGACGACACCGCGCTGCCGGCCGCCACCGGTGCGCTCGAG
CTGGTGCGGCACCTCGTGGCGGAACGCGCCGAGCTGCCGGTGGAGGTGCTTCGGGACGAC
AGCCGGTTCCTCGACGACCTGCACATGAGCTCGATCACCGTCGGCCAGCTCGTCAACGAG
GCCGCCCGCGCCATGGGGCTGTCCGCGGTGGCGATGCCGACCAACTTCGCCACCGCCACC
GTCCGGGAGATGGCCGAGGCGCTGGAGGCCCGGGAGCGCGAGGCCCCGCACGAGCGCGCG
GACCTCGTCGCCGGGGTCGCGCCGTGGGTGCGTACCTTCGTCGTCGACCTGGTCGACGAG
CCGCTGCCGGCGACCGACCCGACGGAGCCGTGCGGCCGCTGGCAGGTGTTCGCGGGCGCC
GACCACCCCCTCGCGGACGCCCTGCGCCGGGCCCTGGAGGCGGCGGGCGTCGGCGAGGGC
GTTCTCGTCTGCCTGCCCGACGAACCCGACGAGGAGCACCTGGTCACCGCGGTGCGCGGG
GCCCAGGCCGCGCTGCGCCAACCGCCCGGCGGGCGGCTCGTGGTGGTGCAGCCGGCGGCG
CGGGCGGGGGCGCTGGCCAAGACCGCCCGGCTGGAGGGCGACCGGCTGCGGACCACCGTC
GTGACCACCCCCCTCGACCCGGCCGCGGTCGACCGGGTGGTCGCCGACGTGGCCGCCACG
GACGACTTCACCGAGGCGGTGTACGACCCGGGCGGCCGCCGTCGGGTGCCCGTGCTGCGC
CCGCTGCCCGCGTCCGACGGCGAGCCGGGCGCCCTGCCGCTGGGCCCGGCCGACGTGCTG
CTGGTGACTGGCGGCGGCAAGGGCATCACGGCCGAGTCCGCGCTGATGCTGGCCCGGGAG
AGCGGTGCCCGACTCGCCGTCCTCGGCCGGTCCGACCCCACCGCCGACGAGGCCCTGGCC
GACAACCTGAAGCGGCTCGCGGACGCCGCGTCCGACCTGCGCTACCTGCGGGTCGACGTC
ACCGACGCCGGCGCGGTGGCCGCCGCGGTCGCCACGGTCACCGCCGACTGGGGCCCGGTG
ACCGCCGTGCTCCACGGCGCCGGGCAGAACACCCCAGCCGCGCTCGCCGACCTGGACGAG
GCGGCCCTGCGGGGCGTGTTCGCCGCCAAGGTCGACGGCCTGCGGGCGGTGCTCGCCGCG
GTCGACCCCGCACGGCTGCGCCTGCTGGTCACGTTCGGCAGCATCATCGGGCGGGCGGGG
CTGCACGGCGAGGCGCACTACGCCGCGGCGAACGAGGCGCTGGCCGAGCTGACCCGGGAG
GTGGCCGCGACGCGGCCGGAGTGCCGCGCCGTCTGCCTGGAGTGGTCGGTGTGGTCCGGG
GTCGGCATGGGGGAGCGGCTGTCGGTGGTCGAGTCGTTGAGCGGCTCCGGCGTCACCCCG
ATCAGCCCGGACGACGGCCTGCGGGTCCTGCGCGAGGTGGTCGCCGACGACACGCTGCCC
CCGGTGGTGGTGGTCACCGGCCGTACCGGCGGCGTGGAGACCCTGCGCTACCACCGCTCC
GAGCTGCCGCTGCTGCGCTTCACCGAACGGCCGTTGGTGCGCTACGACGGCATCGAGCTG
GTGTGCGAGGTCGACCTGGCCCGCACCACGGATCCGTACCTGGAGGACCACCGGCTCGAC
GGCGACCTGCTGTTCCCGGCGGTGCTCGGGTTGGAGGCCATGGCCCAGGTGGCCACCGCC
CTGGCCCGGCACCCGGGAGTGCCCGTGATCGAGGAGGTCCGGTTCGACCGCCCGGTGGTC
GTCGACCCGGACACCGGCACGACCGTACGCGTCGCCGCGCTGGTCCGGTCGGAGCAGGTC
ATCGACGTCGTCCTGCGTAGCGCGGTGACCGGCTTCGCGGCCGACCACTTCCGCGCCCGG
CTCCGGTTCGCGCCGGACGAGACCTACCCGGCGTACACCGCGGCGCCCGCGCCGGCGGAG
CTGCCGGCCGTACCGCTCGACCCGGCCCGCGACCTCTACGGCGACGTGTTGTTCCAGGCC
GGTCGGTTCCGCCGGATCAAGGGCTACCGGCAGGTCGCGGCGCGGGTCGCCGAGGCCGAG
GTGGTCACCAGCGACGCCGCCTCCTGGTTCAGCGCCTTCCTGCCGGGGCGGCTGGTGCTC
GGCGACCCGGGCGCCCGGGACGCGTTCATGCACGGGATCCAGGTGTGCGTGCCGGACGCG
ACGCTGCTGCCGGAGGGCATCGACCGGATCTGGTCGGCGGGCCCCAAGCTGTCGGCCACC
GAGGCCGTGACGATGACCGCGCGGGAACGCGAACAGCACGGCACCGCCTACGTGTACGAC
GTCGTCGTCCGGGACGCCACGGGCGCGGTGATCGAGCACTGGATGGGTCTGCGGCTGCGC
GCCGTGCGTCCGCACGCGCCGCGCGGGTCCTGGCCGCCCGCGCTGCTGGGGCCGCTGCTG
CAACGACGGCTCGCCGAGGTGTTCCCCGGCGACATCGCGGTCGCCGCCGCACCCGGGGGC
GGGCCCCGCGACTCCGGCGCGCTGCTCTCCCGCGCGCTGGGCCAGCCCGTGGTGGTGCGG
CACCGGCCCGACGGGCGGCCGGAGGTCGACCTGCCGTACACCGTCTCCGTGGCGCACTCG
GCGCCGCTCGACCTCGCCGTCGCCGGGGACGGGACGCTCGCCTGCGACGCCGAGCCGGTG
GCCGCCCGCCCGGCGGACGTGCGGCGCGACCTGGTGGGTCGGCACGGCGCGGTGGCGGCG
CTGCTCGTCGCGGAGGTCGGTGATCCGCCGGACGTGGCGGCCACCCGGGTCTGGTGCGCG
GAGGAGTGCCTGCAGAAGGCCGGCCGCCCCGAGGGCCGGCTCACCCTGCTGCCCGGGGCG
CTCCCCGACGGCTGGGTGGTGCTGGACGCCGGCGACGTCCGGGTCGCCACCCGGGTCGTC
GCGGTGGCGGGAGCGGCGGCGCCGGCCGTGGTCGCCGTGCTCAGCGGGGCGGGGAGGTGA
[1] KS2..411
[1] AT621..839
[1] acetyl-CoA malonyl-CoA755..759
[1] ACP925..1017
[1] KR1200..1380
[1] DH1450..1606
[1] PPT1708..1912
[1] KS4..1233
[1] AT1861..2517
[1] acetyl-CoA malonyl-CoA2263..2277
[1] ACP2773..3051
[1] KR3598..4140
[1] DH4348..4818
[1] PPT5122..5736

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [619-686]  1e-35 G3DSA:3.40.366.10 [753-855]  1e-35 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR009081 Acyl carrier protein-like (Domain)
 [931-1046]  3.6000003870074e-08 SSF47336
SSF47336   ACP_like
 [939-1011]  1.4e-05 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR013968 Polyketide synthase, KR (Domain)
 [1200-1380]  6.60000000000002e-30 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [2-288]  8.20000000000006e-51 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [296-411]  1.4e-30 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [621-839]  1.4e-26 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [580-863]  2.50000909916183e-43 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [691-754]  6.09999977126211e-14 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [2-298]  1.80000000000002e-60 G3DSA:3.40.47.10 [300-462]  4.39999999999997e-45 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [1-409]  7.40000780398342e-59 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1198-1387]  6.60000000000002e-31 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit