close all open/close all

CDS information : Calm_00370


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction45,474 / 44,509 / - [in whole cluster]
45,474 / 44,509 / - [in contig]
Locationcomplement(44509..45474) [in whole cluster]
complement(44509..45474) [in contig]
TypeCDS
Length966 bp (321 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.3 uncharacterized protein (biosynthesis involved)
Producthypothetical protein
Product (GenBank)CalT3
GenecalT3
unbU
Gene (GenBank)calT3
EC number
Keyword
  • enediyne core
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)
[12536216] A genomics-guided approach for discovering and expressing cryptic metabolic pathways. (Nat Biotechnol. , 2003)

close this sectionSequence

selected fasta
>hypothetical protein [CalT3]
MTQKPAKDPRITALRRFAISITILNIAGYTVLGFEQAWAWPLIALATGYAVELGLEIIGA
RAERRPPRFRGNGLRGLVEFLYPAHITALAVNMLLYVNDRVPVMMFAVAVAISGKWLFRV
PVNGRLRHFMNPSNFGIAVVLLLFPWISIAPPYQFTEYLEGPADWIVPAVIVVFGTMLNA
KLTGRMWLIAGWLGVFVLQSVVRGLVLDTAILPALATMTGVAFVLFTNYMITDPGTTPSR
PLSQFAFGGGVALVYGVLTGASIVYGLFFATAIVCLIRGGFLWSLHAVRVAARDGKGTPP
AAPGTVDGTVPPAVAREMVRA
selected fasta
>hypothetical protein [CalT3]
ATGACGCAGAAGCCGGCGAAGGACCCGCGGATCACCGCGCTGCGCAGGTTCGCCATCTCC
ATCACCATCCTCAACATCGCCGGCTACACCGTGCTCGGCTTCGAGCAGGCCTGGGCGTGG
CCGCTGATCGCGCTCGCCACCGGCTACGCCGTCGAGCTCGGGCTGGAGATCATCGGCGCG
CGGGCCGAGCGGCGCCCGCCCCGGTTCCGCGGCAACGGCCTGCGCGGCCTGGTCGAGTTC
CTCTACCCCGCGCACATCACCGCCCTCGCGGTGAACATGCTGCTGTACGTCAACGACCGC
GTGCCGGTGATGATGTTCGCGGTGGCCGTGGCGATCAGCGGGAAGTGGCTGTTCCGGGTG
CCGGTCAACGGCCGGCTGCGGCACTTCATGAACCCGTCGAACTTCGGCATCGCGGTGGTG
CTGCTGCTGTTCCCGTGGATCTCGATCGCCCCGCCGTACCAGTTCACCGAGTACCTGGAG
GGCCCCGCCGACTGGATCGTCCCCGCGGTCATCGTCGTCTTCGGCACCATGCTCAACGCG
AAGCTCACCGGCCGGATGTGGCTGATCGCCGGCTGGCTGGGCGTCTTCGTGCTCCAGTCG
GTGGTGCGGGGACTCGTGCTGGACACCGCCATCCTGCCGGCGCTGGCCACCATGACCGGG
GTGGCGTTCGTCCTGTTCACGAACTACATGATCACCGACCCGGGGACGACCCCGTCGCGG
CCGCTGTCCCAGTTCGCCTTCGGTGGCGGGGTGGCCCTGGTGTACGGCGTCCTCACCGGC
GCGTCCATCGTCTACGGCCTCTTCTTCGCCACCGCCATCGTCTGTCTGATCCGGGGCGGC
TTCCTCTGGTCGCTGCACGCGGTACGCGTCGCCGCCCGCGACGGCAAGGGCACGCCGCCC
GCCGCCCCGGGGACCGTCGACGGCACGGTGCCACCCGCCGTGGCCCGCGAGATGGTGCGG
GCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM
 [13-32]  Transmembrane (i-o) [37-59]  Transmembrane (o-i) [80-97]  Transmembrane (i-o) [101-120]  Transmembrane (o-i) [133-155]  Transmembrane (i-o) [183-205]  Transmembrane (o-i) [210-232]  Transmembrane (i-o) [247-269]  Transmembrane (o-i)
Transmembrane 8