close all open/close all

CDS information : Calm_00380


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction47,426 / 45,471 / - [in whole cluster]
47,426 / 45,471 / - [in contig]
Locationcomplement(45471..47426) [in whole cluster]
complement(45471..47426) [in contig]
TypeCDS
Length1,956 bp (651 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.3 uncharacterized protein (biosynthesis involved)
Producthypothetical protein
Product (GenBank)CalU14
GenecalU14
unbV
Gene (GenBank)calU14
EC number
Keyword
  • enediyne core
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)
[12536216] A genomics-guided approach for discovering and expressing cryptic metabolic pathways. (Nat Biotechnol. , 2003)
Related Reference
ACC
Q84HJ0
NITE
Dynm_00160
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [CalU14]
MFRRQLAGLVALVLLTGMYVLVRQPEANADERRAMAEPYRFTPMSLPMPGGLPQQSIRRV
NGAYQHLAAWISSVGAGAAMNDLDGDGLANDLCVTDPRVDRVVVTPAPTAGADRYQPFVL
DPAPLPMNPYVAPMGCLPGDLNADGRTDLLVYWWGRTPVVFLARADATGLSRAAYHPVEL
VPGAATGGSRYDGPKWNTNAATLADFDGDGHLDVYIGNYFPDSAVLDDTVHGGVAMNRSM
SNGLNGGEDHVFRWTGGTAGATPSASFAEVPDVFDTKVSRGWTLAVAANDLDGDQLPELY
VANDFGPDRLLHNRSERGRIAFAPVESPGLPGLTPKSKRLGHDSFKGMGVDFGDIDGDGM
FDLYVGNITTSFGIQESNFAFVNTAADTAALRAALWAGEAPWHDRSAELGLAWSGWSWDV
KFGDFTNRGDPAIVQTSGFVKGEVNRWAQLQEAATANDDLLANPRWWPKVEQGDDIAGGQ
HLAFHVRGADGRYEDLSHELGLADRVPSRGIATADADGDGRLDLVVARQWDAPVFYRNDS
PDTGSFLTLRLLHEQAPAAGPLAGAGSPVVGAQVRVTTPDGRVLIDRVDGGSGHSGRRSN
EVSLGLDDVTGPVSVHLTWRDRSGAPHEQELTLAPGRHTLTLGSQAREVSR
selected fasta
>hypothetical protein [CalU14]
ATGTTCCGCCGGCAGTTGGCCGGGCTGGTCGCGCTGGTGCTGCTCACCGGCATGTACGTG
CTGGTCCGGCAGCCGGAGGCGAACGCCGACGAGCGGCGCGCCATGGCGGAGCCGTACCGG
TTCACGCCGATGTCGCTGCCGATGCCGGGCGGCCTGCCGCAGCAGTCGATCCGCCGGGTC
AACGGCGCGTACCAGCACCTGGCGGCGTGGATCTCCTCCGTCGGCGCCGGCGCCGCGATG
AACGACCTGGACGGTGACGGACTGGCCAACGACCTGTGCGTCACCGACCCACGCGTCGAC
CGCGTCGTGGTGACCCCGGCCCCGACCGCCGGCGCCGACCGCTACCAGCCGTTCGTGCTG
GACCCGGCGCCGCTGCCGATGAACCCGTACGTCGCCCCGATGGGCTGCCTGCCCGGCGAC
CTCAACGCCGACGGCCGCACCGACCTGCTCGTGTACTGGTGGGGCCGGACCCCGGTGGTC
TTCCTGGCCCGGGCGGACGCGACCGGGCTGTCCCGGGCCGCCTACCACCCCGTCGAGCTG
GTGCCGGGCGCGGCGACCGGCGGTAGCCGGTACGACGGGCCGAAGTGGAACACCAACGCC
GCGACGCTGGCCGACTTCGACGGCGACGGGCACCTGGACGTCTACATCGGCAACTACTTC
CCCGACAGCGCCGTCCTCGACGACACCGTCCACGGCGGGGTGGCGATGAACCGGTCCATG
TCCAACGGCCTCAACGGCGGCGAGGACCACGTGTTCCGGTGGACCGGCGGCACCGCCGGC
GCCACGCCGAGCGCCTCCTTCGCCGAGGTCCCGGACGTCTTCGACACCAAGGTCTCCCGG
GGCTGGACGCTCGCCGTCGCCGCGAACGACCTCGACGGCGACCAACTGCCCGAGCTGTAC
GTGGCCAACGACTTCGGGCCGGACCGGCTGCTGCACAACCGGTCGGAGCGGGGGCGGATC
GCCTTCGCGCCGGTCGAGAGCCCCGGGCTGCCCGGCCTGACCCCCAAGTCAAAGCGGCTC
GGCCACGACTCGTTCAAGGGCATGGGCGTGGACTTCGGCGACATCGACGGCGACGGCATG
TTCGACCTGTACGTCGGCAACATCACCACCTCCTTCGGCATCCAGGAGAGCAACTTCGCC
TTCGTCAACACCGCCGCCGACACCGCCGCGCTGCGCGCCGCGCTGTGGGCCGGCGAGGCG
CCGTGGCACGACCGCAGCGCCGAGCTGGGCCTGGCCTGGAGCGGGTGGAGCTGGGACGTC
AAGTTCGGCGACTTCACCAACCGCGGCGACCCGGCGATCGTGCAGACCTCCGGCTTCGTC
AAGGGCGAGGTCAACCGCTGGGCGCAGTTGCAGGAGGCGGCCACCGCCAACGACGACCTG
CTCGCCAACCCCCGCTGGTGGCCGAAGGTCGAGCAGGGCGACGACATCGCCGGCGGCCAG
CACCTCGCCTTCCACGTCCGGGGCGCCGACGGCCGCTACGAGGACCTCAGCCACGAACTG
GGCCTGGCCGACCGGGTGCCCAGCCGGGGCATCGCCACCGCCGACGCCGACGGCGACGGG
CGCCTCGACCTCGTCGTCGCCCGGCAGTGGGACGCGCCGGTCTTCTACCGCAACGACAGC
CCGGACACCGGTTCCTTCCTCACCCTGCGGCTGCTGCACGAGCAGGCGCCGGCCGCCGGC
CCCCTCGCCGGGGCGGGGTCGCCGGTCGTCGGCGCGCAGGTCCGGGTGACCACGCCGGAC
GGCCGGGTGCTCATCGACCGGGTCGACGGCGGCAGCGGCCACTCGGGCCGGCGCAGCAAC
GAGGTGTCGCTCGGTCTCGACGACGTGACCGGCCCGGTGTCGGTCCACCTCACCTGGCGG
GACCGGTCCGGCGCCCCGCACGAGCAGGAGCTGACGCTGGCCCCCGGTCGACACACCCTC
ACCCTCGGTTCGCAGGCTCGGGAGGTCTCGCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011519 ASPIC/UnbV (Domain)
 [568-641]  1.8e-19 PF07593
PF07593   UnbV_ASPIC
SignalP
 [1-29]  0.525 Signal
Bacteria, Gram-positive   
 [1-29]  0.636 Signal
Eukaryota   
TMHMM No significant hit