close all open/close all

CDS information : Calm_00390


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction48,416 / 47,448 / - [in whole cluster]
48,416 / 47,448 / - [in contig]
Locationcomplement(47448..48416) [in whole cluster]
complement(47448..48416) [in contig]
TypeCDS
Length969 bp (322 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.3 uncharacterized protein (biosynthesis involved)
Producthypothetical protein
Product (GenBank)CalU15
GenecalU15
unbL
Gene (GenBank)calU15
EC number
Keyword
  • enediyne core
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)
[12536216] A genomics-guided approach for discovering and expressing cryptic metabolic pathways. (Nat Biotechnol. , 2003)
[18529057] Characterization of a carbonyl-conjugated polyene precursor in 10-membered enediyne biosynthesis. (J Am Chem Soc. , 2008)
Related Reference
ACC
Q84HJ1
NITE
Dynm_00150
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [CalU15]
MPANWRTIRQYALTPGMAQTTFATRGFRARDEPTRERLESVGAHFLTGYGHAVGARGPDE
AVGALETVAPDLRGFAYEGAAMGLAVLDGLTGGRRIARFLAGPAARHVYMVHVGVGWAMA
RLPRWRRHAIQPADRLLGWLALDGYGFHQAYFHTRRYVWSHRRDEVLPWPGDPIGRWTGR
VVDQGIGRALWFVEGADTDRIADTVDGFPPDRHEDLYSGVALAATYAGGAPPEDLRRLRE
RGGAYAPAMAQGSAFAAEARERAGLTTAHTAVATDVFCGAPPAEAAAVTQAALADLDRDG
PEPAYLVWRQRIAKQFVTLGRC
selected fasta
>hypothetical protein [CalU15]
ATGCCCGCCAATTGGCGAACCATTCGTCAATACGCCCTGACGCCGGGGATGGCCCAGACC
ACCTTCGCGACCCGGGGCTTCCGCGCCCGGGACGAGCCGACCCGCGAGCGGCTGGAGTCG
GTCGGCGCCCACTTCCTCACCGGCTACGGGCACGCCGTCGGCGCCCGGGGCCCGGACGAG
GCCGTCGGGGCGCTGGAGACCGTCGCGCCGGACCTGCGCGGGTTCGCGTACGAGGGCGCG
GCGATGGGCCTCGCCGTCCTGGACGGGCTGACCGGTGGCCGCCGGATCGCCCGGTTCCTG
GCCGGGCCGGCCGCCCGGCACGTGTACATGGTCCATGTCGGGGTGGGCTGGGCGATGGCC
CGCCTGCCCCGCTGGCGTCGGCACGCGATCCAACCCGCCGACCGGCTGCTGGGCTGGCTG
GCGCTGGACGGCTACGGATTCCACCAGGCGTACTTCCACACCCGGCGGTACGTGTGGTCG
CACCGGCGTGACGAGGTGCTGCCCTGGCCCGGCGACCCGATCGGGCGGTGGACCGGGCGC
GTCGTGGACCAGGGCATCGGCCGCGCGCTGTGGTTCGTCGAGGGCGCCGACACCGACCGG
ATCGCCGACACCGTCGACGGCTTCCCGCCGGACCGGCACGAGGACCTGTACAGCGGGGTG
GCGCTGGCCGCCACGTACGCCGGCGGGGCGCCGCCCGAGGACCTGCGGCGGCTGCGCGAG
CGCGGCGGAGCGTACGCCCCGGCGATGGCCCAGGGCAGCGCCTTCGCGGCGGAGGCCCGG
GAGCGCGCCGGGCTGACCACCGCGCACACCGCGGTCGCCACCGACGTCTTCTGCGGCGCG
CCACCGGCCGAGGCGGCGGCGGTCACCCAGGCCGCGCTGGCCGACCTCGACCGGGACGGG
CCGGAGCCGGCCTACCTGGTGTGGCGGCAGCGGATCGCCAAGCAGTTCGTGACGCTGGGG
AGGTGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR012964 Protein of unknown function DUF1702 (Family)
 [1-317]  PF08012
PF08012   DUF1702
SignalP No significant hit
TMHMM No significant hit