close all open/close all

CDS information : Calm_00410


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction49,636 / 50,997 / + [in whole cluster]
49,636 / 50,997 / + [in contig]
Location49636..50997 [in whole cluster]
49636..50997 [in contig]
TypeCDS
Length1,362 bp (453 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductNDP-alpha-D-glucose dehydrogenase
Product (GenBank)CalS8
Gene
Gene (GenBank)calS8
EC number1.1.1.-
Keyword
  • aminodideoxypentose
Note
  • dTDP-alpha-D-glucose can be efficiently oxidized.
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)
[12404643] On the origin of deoxypentoses: evidence to support a glucose progenitor in the biosynthesis of calicheamicin. (Chembiochem. , 2002)
[19058170] Natural-product sugar biosynthesis and enzymatic glycodiversification. (Angew Chem Int Ed Engl. , 2008)
[26240141] Structural Characterization of CalS8, a TDP-alpha-D-Glucose Dehydrogenase Involved in Calicheamicin Aminodideoxypentose Biosynthesis. (J Biol Chem. , 2015)
Related Reference
ACC
Q0H2W3
PmId
[26289554] Characterization of Early Enzymes Involved in TDP-Aminodideoxypentose Biosynthesis en Route to Indolocarbazole AT2433. (Chembiochem. , 2015)

close this sectionSequence

selected fasta
>NDP-alpha-D-glucose dehydrogenase [CalS8]
MPFLPDPGEPSPLKVVIAGAGYVGTCLAVTLAGRGAEVVAVDSDPGTVADLRAGRCRLPE
PGLAGAVRDLAATGRLTASTSYDPVGAADVVIVTVGTPTDAGHEMVTDQLVAACEQIAPR
LRAGQLVILKSTVSPGTTRTLVAPLLESGGLVHERDFGLAFCPERLAEGVALAQVRTLPV
VVGGCGPRSAAAAERFWRSALGVDVRQVPSAESAEVVKLATNWWIDANVAIANELARYCA
VLGVDVLDVIGAANTLPKGSSMVNLLLPGVGVGGSCLTKDPWMAWRDGRDRGVPLRTVET
ARAVNDDMPRHTAAVIADELVKLGRDRNDTTIAVLGAAFKNDTGDVRNTPVRGVVAALRD
SGFRVRIFDPLADPAEIVARFGTAPAASLDEAVSGAGCLAFLAGHRQFHELDFGALAERV
DEPCLVFDGRMHLPPARIRELHRFGFAYRGIGR
selected fasta
>NDP-alpha-D-glucose dehydrogenase [CalS8]
ATGCCGTTCCTTCCCGACCCGGGCGAACCGTCCCCGCTGAAGGTGGTCATCGCCGGCGCC
GGCTACGTCGGCACCTGTCTCGCCGTCACCCTCGCCGGCCGCGGCGCCGAGGTGGTCGCG
GTCGACAGCGACCCGGGCACCGTCGCGGACCTGCGGGCCGGCCGGTGCCGGCTGCCCGAG
CCCGGCCTGGCCGGCGCCGTCCGGGACCTCGCCGCGACCGGACGGCTGACGGCGAGCACG
TCGTACGACCCGGTCGGCGCGGCGGACGTGGTGATCGTGACGGTCGGCACCCCGACCGAC
GCCGGCCACGAGATGGTCACCGACCAGCTCGTCGCGGCGTGCGAGCAGATCGCCCCGCGG
CTGCGCGCCGGGCAACTGGTGATCCTCAAGTCGACGGTCTCCCCGGGCACCACCCGGACC
CTCGTCGCGCCCCTGCTGGAGAGCGGCGGGCTGGTGCACGAGCGCGACTTCGGGCTGGCC
TTCTGCCCGGAGCGGCTCGCCGAGGGGGTGGCGCTGGCGCAGGTGCGGACGCTGCCGGTG
GTGGTGGGTGGGTGCGGCCCGCGCAGCGCCGCCGCGGCCGAACGGTTCTGGCGGTCCGCG
CTCGGCGTCGACGTCCGGCAGGTGCCGTCGGCCGAGTCCGCCGAGGTGGTCAAGCTCGCG
ACCAACTGGTGGATCGACGCGAACGTGGCGATCGCCAACGAACTCGCCCGGTACTGCGCG
GTGCTGGGGGTGGACGTCCTCGACGTGATCGGCGCGGCGAACACCCTGCCCAAGGGCAGC
AGCATGGTGAACCTGCTGCTGCCGGGGGTGGGTGTCGGCGGCTCCTGCCTGACGAAGGAC
CCGTGGATGGCGTGGCGGGACGGCCGGGACCGGGGCGTGCCCCTGCGCACGGTCGAGACG
GCCCGCGCGGTCAACGACGACATGCCCCGCCACACCGCCGCCGTCATCGCCGACGAGCTG
GTCAAGCTGGGACGGGATCGGAACGACACGACGATCGCCGTGCTCGGCGCGGCGTTCAAG
AACGACACCGGCGACGTCCGCAACACCCCGGTGCGCGGGGTCGTGGCGGCGCTGCGCGAC
AGCGGCTTCCGGGTCCGGATCTTCGACCCGCTGGCCGATCCCGCCGAGATCGTCGCCCGG
TTCGGCACCGCGCCGGCGGCGAGCCTGGACGAGGCGGTGAGCGGGGCGGGCTGCCTGGCC
TTCCTCGCCGGGCACCGCCAGTTCCACGAGCTCGACTTCGGCGCCCTGGCCGAGCGGGTG
GACGAGCCCTGCCTGGTCTTCGACGGCCGCATGCACCTCCCGCCGGCGCGCATCCGCGAG
CTGCACCGGTTCGGCTTCGCCTACCGCGGCATTGGAAGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001732 UDP-glucose/GDP-mannose dehydrogenase, N-terminal (Domain)
 [14-191]  2.80000000000001e-42 PF03721
PF03721   UDPG_MGDP_dh_N
IPR008927 6-phosphogluconate dehydrogenase, C-terminal-like (Domain)
 [211-308]  9.70001793430487e-28 SSF48179
SSF48179   6DGDH_C_like
IPR014026 UDP-glucose/GDP-mannose dehydrogenase, dimerisation (Domain)
 [212-308]  1.69999999999999e-19 PF00984
PF00984   UDPG_MGDP_dh
IPR014027 UDP-glucose/GDP-mannose dehydrogenase, C-terminal (Domain)
 [333-435]  4.10001399699315e-33 SM00984
SM00984   UDPG_MGDP_dh_C
 [333-432]  1.6e-21 PF03720
PF03720   UDPG_MGDP_dh_C
 [317-446]  1.39999892049878e-28 SSF52413
SSF52413   UDP-Glc/GDP-Man_DH_C
IPR016040 NAD(P)-binding domain (Domain)
 [13-233]  8.60000000000004e-51 G3DSA:3.40.50.720 [243-453]  3.7e-52 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR017476 Nucleotide sugar dehydrogenase (Family)
 [4-450]  PIRSF000124
PIRSF000124   UDPglc_GDPman_dh
 [14-430]  1.39999999999997e-103 TIGR03026
TIGR03026   NDP-sugDHase
SignalP No significant hit
TMHMM No significant hit