close all open/close all

CDS information : Calm_00420


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction51,004 / 51,993 / + [in whole cluster]
51,004 / 51,993 / + [in contig]
Location51004..51993 [in whole cluster]
51004..51993 [in contig]
TypeCDS
Length990 bp (329 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductUDP-glucuronic acid decarboxylase
Product (GenBank)CalS9
Gene
Gene (GenBank)calS9
EC number
Keyword
  • aminodideoxypentose
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)
[19290519] Characterization of CalS9 in the biosynthesis of UDP-xylose and the production of xylosyl-attached hybrid compound. (Appl Microbiol Biotechnol. , 2009)
[19058170] Natural-product sugar biosynthesis and enzymatic glycodiversification. (Angew Chem Int Ed Engl. , 2008)
[26289554] Characterization of Early Enzymes Involved in TDP-Aminodideoxypentose Biosynthesis en Route to Indolocarbazole AT2433. (Chembiochem. , 2015)
Related Reference
ACC
Q0H2W2
PmId
[26289554] Characterization of Early Enzymes Involved in TDP-Aminodideoxypentose Biosynthesis en Route to Indolocarbazole AT2433. (Chembiochem. , 2015)

close this sectionSequence

selected fasta
>UDP-glucuronic acid decarboxylase [CalS9]
MPRSLVTGGFGFVGSHVVERLVRRGDEVVVYDLADPPPDLEHPPGAIRHVRGDVRDADGL
AAAATGVDEVYHLAAVVGVDRYLSRPLDVVEINVDGTRNALRAALRAGARVVVSSTSEVY
GRNPRVPWREDDDRVLGSTATDRWSYSTSKAAAEHLAFAFHRQEGLPVTVLRYFNVYGPR
QRPAYVLSRTVARLLRGVPPVVYDDGRQTRCFTWIDEAAEATLLAAAHPRAVGECFNIGS
SVETTVAEAVRLAGTVAGVPVAAQTADTGAGLGARYQDIPRRVPDCGKAAALLDWRARVP
LVTGLRRTVEWARRNPWWTAQADDGLVVR
selected fasta
>UDP-glucuronic acid decarboxylase [CalS9]
GTGCCCAGATCCCTGGTCACCGGCGGCTTCGGCTTCGTCGGCAGTCACGTCGTCGAACGG
CTGGTCCGCCGGGGTGACGAGGTCGTCGTCTACGACCTCGCCGACCCGCCGCCCGACCTG
GAGCACCCGCCGGGCGCGATCCGGCACGTCCGCGGCGACGTCCGGGACGCCGACGGGCTG
GCGGCCGCCGCCACCGGCGTGGACGAGGTCTACCACCTCGCGGCGGTCGTCGGCGTCGAC
CGGTACCTCAGCCGGCCGCTGGACGTGGTCGAGATCAACGTGGACGGCACCCGGAACGCG
TTGCGCGCCGCACTGCGCGCCGGTGCCCGGGTCGTGGTGTCCAGCACCAGCGAGGTGTAC
GGGCGCAATCCGCGGGTGCCGTGGCGGGAGGACGACGACCGGGTGCTCGGCAGCACGGCG
ACGGACCGGTGGTCGTACTCGACGAGCAAGGCGGCGGCCGAGCACCTGGCCTTCGCCTTC
CACCGGCAGGAGGGCCTGCCGGTGACGGTGCTGCGGTACTTCAACGTCTACGGCCCACGC
CAGCGCCCGGCGTACGTCCTCAGCCGCACCGTCGCCCGCCTGCTGCGGGGCGTTCCGCCC
GTGGTGTACGACGACGGCCGCCAGACGCGGTGCTTCACCTGGATCGACGAGGCGGCCGAG
GCGACCCTGCTGGCCGCCGCCCACCCGCGGGCCGTCGGCGAGTGTTTCAACATCGGCAGC
AGCGTGGAGACCACCGTCGCCGAGGCGGTCCGGCTGGCCGGCACGGTGGCCGGGGTGCCG
GTGGCGGCCCAGACCGCGGACACCGGAGCCGGGCTCGGCGCCCGCTACCAGGACATTCCC
CGCCGCGTACCGGACTGCGGCAAGGCCGCCGCGCTGCTGGACTGGCGGGCCCGGGTGCCG
CTGGTGACCGGCCTGCGCCGGACCGTCGAGTGGGCCCGCCGCAACCCGTGGTGGACCGCC
CAGGCCGACGACGGACTGGTCGTCAGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [5-239]  1.2e-54 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [4-192]  3.29999999999997e-57 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [133-161]  PS00061
PS00061   ADH_SHORT
SignalP No significant hit
TMHMM No significant hit