close all open/close all

CDS information : Calm_00430


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction52,950 / 52,213 / - [in whole cluster]
52,950 / 52,213 / - [in contig]
Locationcomplement(52213..52950) [in whole cluster]
complement(52213..52950) [in contig]
TypeCDS
Length738 bp (245 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-sugar N-methyltransferase
Product (GenBank)CalS10
Gene
Gene (GenBank)calS10
EC number2.1.1.-
Keyword
  • aminodideoxypentose
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)
[19058170] Natural-product sugar biosynthesis and enzymatic glycodiversification. (Angew Chem Int Ed Engl. , 2008)
Related Reference
ACC
Q9ZGH6
NITE
Pikro_00100
PmId
[9770448] A gene cluster for macrolide antibiotic biosynthesis in Streptomyces venezuelae: architecture of metabolic diversity. (Proc Natl Acad Sci U S A. , 1998)
[12119032] Expression, purification, and characterization of two N,N-dimethyltransferases, tylM1 and desVI, involved in the biosynthesis of mycaminose and desosamine. (Biochemistry. , 2002)

close this sectionSequence

selected fasta
>putative NDP-sugar N-methyltransferase [CalS10]
MFGPEHAEVYEAAYRGRGKSWHDEAADVADRIRAARPDAARLLDVGCGTGAHLETFATRF
PHVEGLELAPAMLALARHRLPGVRLHAGDMRTFDLGVTFDAVTCLFTAVNFLGTVAEMRA
AVAAMSAHLAPGGVLVLEPWWFPERFIDGYVGGDLVREEGRTVARVSRSTRQGRVTRMEE
RWLVGDAAGIREFSQVGLLTMFTREEYDAAFAAAGCESAYVEGWLTGRGLFVATRTGGHA
TPTMV
selected fasta
>putative NDP-sugar N-methyltransferase [CalS10]
ATGTTCGGACCGGAGCACGCCGAGGTGTACGAGGCCGCCTACCGCGGCCGCGGCAAGAGC
TGGCACGACGAGGCGGCGGACGTGGCCGACCGGATCCGGGCCGCCCGCCCCGACGCCGCC
CGGCTGCTCGACGTCGGCTGCGGCACCGGCGCGCACCTCGAGACCTTCGCGACCCGCTTC
CCCCACGTGGAGGGGCTCGAACTGGCCCCGGCGATGCTGGCGCTCGCCCGACACCGGCTG
CCCGGGGTGCGCCTGCACGCCGGGGACATGCGGACGTTCGACCTTGGCGTCACGTTCGAC
GCGGTGACCTGCCTGTTCACCGCGGTCAACTTCCTCGGCACGGTGGCCGAGATGCGGGCG
GCCGTGGCCGCGATGTCGGCCCACCTGGCGCCGGGCGGCGTGCTGGTGCTCGAACCGTGG
TGGTTCCCGGAGCGGTTCATCGACGGGTACGTCGGCGGCGACCTGGTGCGCGAGGAGGGC
CGCACGGTGGCGCGGGTGTCGCGGTCCACCCGGCAGGGACGGGTGACGCGGATGGAGGAG
CGCTGGCTCGTCGGCGACGCCGCCGGGATCCGGGAGTTCAGCCAGGTCGGCCTGCTCACC
ATGTTCACCCGCGAGGAGTACGACGCGGCGTTCGCCGCTGCCGGCTGCGAGTCCGCGTAC
GTCGAGGGCTGGCTGACCGGCCGGGGCCTTTTCGTGGCGACGCGTACCGGTGGACACGCC
ACCCCGACAATGGTTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit