close all open/close all

CDS information : Calm_00440


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction53,061 / 53,453 / + [in whole cluster]
53,061 / 53,453 / + [in contig]
Location53061..53453 [in whole cluster]
53061..53453 [in contig]
TypeCDS
Length393 bp (130 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative ArsR family transcriptional regulator
Product (GenBank)CalR8
Gene
Gene (GenBank)calR8
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)
Family/Domain
FD
IPR001845

close this sectionSequence

selected fasta
>putative ArsR family transcriptional regulator [CalR8]
MHAFDILGDPVRRRIIELLADGELSAGEVGAVVQREFGISQPGVSQHLRVLRENGFATVR
PQGTRRLYAVDPAPLQELDRWLERYRRFWNQRLDALGTEIARGRARQGEGRAGGSEGRPP
RRRAAADGQD
selected fasta
>putative ArsR family transcriptional regulator [CalR8]
GTGCACGCGTTCGACATCCTGGGCGACCCCGTCCGCCGGCGCATCATCGAGCTGCTGGCG
GACGGCGAGCTGTCGGCCGGCGAGGTCGGTGCGGTCGTGCAGCGCGAGTTCGGCATCTCC
CAGCCCGGCGTCTCCCAGCACCTGCGGGTGCTGCGCGAGAACGGCTTCGCCACCGTCCGC
CCGCAGGGCACGCGGCGGCTCTACGCGGTCGACCCCGCCCCGCTGCAGGAGCTCGACCGG
TGGCTGGAGCGCTACCGGCGATTCTGGAACCAGCGCCTCGACGCCCTGGGCACGGAGATC
GCGCGCGGTCGCGCCCGCCAGGGCGAGGGCCGCGCCGGCGGGTCCGAGGGGCGACCACCT
CGCCGCCGCGCGGCCGCCGACGGCCAGGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001845 HTH ArsR-type DNA-binding domain (Domain)
 [2-84]  1e-23 SM00418
SM00418   HTH_ARSR
 [1-90]  PS50987
PS50987   HTH_ARSR_2
 [4-19]  1.20000117458134e-10 PR00778 [40-55]  1.20000117458134e-10 PR00778 [55-70]  1.20000117458134e-10 PR00778
PR00778   HTHARSR
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [3-104]  2.5e-30 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
SignalP No significant hit
TMHMM No significant hit