close all open/close all

CDS information : Calm_00450


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction54,689 / 53,511 / - [in whole cluster]
54,689 / 53,511 / - [in contig]
Locationcomplement(53511..54689) [in whole cluster]
complement(53511..54689) [in contig]
TypeCDS
Length1,179 bp (392 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productglycosyltransferase
Product (GenBank)CalG1
Gene
Gene (GenBank)calG1
EC number
Keyword
  • 3-methoxy-L-rhamnose
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)
[16946071] Exploiting the reversibility of natural product glycosyltransferase-catalyzed reactions. (Science. , 2006)
[21987796] Complete set of glycosyltransferase structures in the calicheamicin biosynthetic pathway reveals the origin of regiospecificity. (Proc Natl Acad Sci U S A. , 2011)

close this sectionSequence

selected fasta
>glycosyltransferase [CalG1]
MRVLFASLGTHGHTYPLLPLATAARAAGHEVTFATGEGFAGTLRKLGFEPVATGMPVFDG
FLAALRIRFDTDSPEGLTPEQLSELPQIVFGRVIPQRVFDELQPVIERLRPDLVVQEISN
YGAGLAALKAGIPTICHGVGRDTPDDLTRSIEEEVRGLAQRLGLDLPPGRIDGFGNPFID
IFPPSLQEPEFRARPRRHELRPVPFAEQGDLPAWLSSRDTARPLVYLTLGTSSGGTVEVL
RAAIDGLAGLDADVLVASGPSLDVSGLGEVPANVRLESWVPQAALLPHVDLVVHHGGSGT
TLGALGAGVPQLSFPWAGDSFANAQAVAQAGAGDHLLPDNISPDSVSGAAKRLLAEESYR
AGARAVAAEIAAMPGPDEVVRLLPGFASRSAG
selected fasta
>glycosyltransferase [CalG1]
GTGCGTGTGCTGTTCGCCAGTCTCGGAACCCATGGCCACACCTACCCCCTGCTGCCACTG
GCCACGGCCGCCCGTGCGGCGGGCCACGAGGTCACCTTCGCCACCGGCGAGGGCTTCGCG
GGCACCCTGCGGAAGCTGGGCTTCGAGCCGGTCGCGACCGGGATGCCGGTCTTCGACGGG
TTCCTGGCGGCGCTGCGGATCCGCTTCGACACCGACAGCCCCGAGGGGCTGACCCCCGAG
CAGCTCAGTGAGCTGCCGCAGATCGTGTTCGGGCGGGTCATCCCGCAGCGCGTCTTCGAC
GAGCTCCAGCCGGTGATCGAACGGTTGCGACCCGACCTCGTGGTGCAGGAGATCAGCAAC
TACGGCGCCGGCCTGGCCGCCCTGAAGGCGGGCATCCCGACCATCTGCCACGGGGTCGGC
CGGGACACGCCGGACGACCTGACCCGGTCCATCGAGGAGGAGGTGCGGGGGCTGGCCCAG
CGGCTCGGCCTCGACCTGCCGCCCGGGCGCATCGACGGCTTCGGCAACCCCTTCATCGAC
ATCTTCCCGCCGTCGCTGCAGGAGCCGGAGTTCCGGGCCCGCCCGCGGCGCCACGAGCTG
CGCCCGGTGCCCTTCGCCGAGCAGGGTGACCTCCCGGCCTGGCTGTCCTCGCGCGACACG
GCCCGCCCGCTGGTCTACCTGACGCTCGGCACGTCCAGCGGCGGCACCGTCGAGGTGCTG
CGGGCGGCGATCGACGGGCTCGCCGGCCTCGACGCCGACGTCCTGGTCGCCAGCGGCCCG
TCCCTCGACGTCAGCGGACTGGGCGAGGTGCCGGCAAACGTACGGCTCGAGTCGTGGGTG
CCGCAGGCGGCCCTGCTGCCCCACGTCGACCTGGTGGTGCACCACGGGGGCAGCGGCACT
ACGCTCGGCGCACTGGGCGCCGGCGTGCCGCAGCTGTCCTTCCCGTGGGCGGGGGACTCG
TTCGCCAACGCGCAGGCGGTGGCGCAGGCCGGCGCCGGTGACCACCTGCTGCCCGACAAC
ATCAGCCCCGACTCGGTGTCGGGCGCCGCGAAGCGCCTGTTGGCCGAGGAGAGCTACCGG
GCCGGGGCGCGGGCCGTGGCGGCCGAGATCGCGGCCATGCCGGGCCCCGACGAGGTCGTC
CGCCTGCTGCCGGGCTTCGCCTCCAGGAGCGCGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [3-80]  9.7e-10 PF03033
PF03033   Glyco_transf_28
IPR007235 Glycosyl transferase, family 28, C-terminal (Domain)
 [284-360]  3e-06 PF04101
PF04101   Glyco_tran_28_C
IPR010610 Domain of unknown function DUF1205 (Domain)
 [179-275]  1.5e-13 PF06722
PF06722   DUF1205
SignalP No significant hit
TMHMM No significant hit