close all open/close all

CDS information : Calm_00460


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction54,904 / 55,677 / + [in whole cluster]
54,904 / 55,677 / + [in contig]
Location54904..55677 [in whole cluster]
54904..55677 [in contig]
TypeCDS
Length774 bp (257 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductdTDP-rhamnose C-3 O-methyltransferase
Product (GenBank)CalS11
Gene
Gene (GenBank)calS11
EC number2.1.1.-
Keyword
  • 3-methoxy-L-rhamnose
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)
[23662776] Structural and Functional Characterization of CalS11, a TDP-Rhamnose 3'-O-Methyltransferase Involved in Calicheamicin Biosynthesis. (ACS Chem Biol. , 2013)
[19058170] Natural-product sugar biosynthesis and enzymatic glycodiversification. (Angew Chem Int Ed Engl. , 2008)
[26958582] Loop dynamics of thymidine diphosphate-rhamnose 3'-O-methyltransferase (CalS11), an enzyme in calicheamicin biosynthesis. (Struct Dyn. , 2016)
Related Reference
ACC
Q9S0P0
NITE
Aver_00170
PmId
[11451669] Insights about the biosynthesis of the avermectin deoxysugar L-oleandrose through heterologous expression of Streptomyces avermitilis deoxysugar genes in Streptomyces lividans. (Chem Biol. , 2001)

close this sectionSequence

selected fasta
>dTDP-rhamnose C-3 O-methyltransferase [CalS11]
MDSGDGQDLRAFVHDSPEETETTQRLTKLLTNSPIPTEELVNNLPLFLRRHQMTDLLSMD
ALYRQVLDVPGVIMEFGVRFGRHLGTFAALRGVYEPYNPLRRIVGFDTFTGFPDVNDVDR
VGPTAYQGRFAVPGGYPAYLKEVLDAHECSDFFGHVTQRSVLVEGDVRETVPRYLAENPQ
TVIALAYFDLDLYEPTKAVLEAIRPYLTKGSIVAFDELDNPKWPGENIAMRKVLGLDHAP
LRLLPGRPAPAYLRWGD
selected fasta
>dTDP-rhamnose C-3 O-methyltransferase [CalS11]
ATGGACAGCGGCGACGGTCAGGACCTGCGTGCGTTCGTGCACGACTCACCGGAGGAGACG
GAGACCACCCAGCGCCTGACGAAGCTCTTGACCAACTCTCCGATCCCCACGGAGGAACTG
GTCAACAACCTCCCCCTGTTCCTGCGCCGCCACCAGATGACCGATCTGCTCTCGATGGAC
GCGCTCTACCGTCAGGTCCTCGACGTGCCGGGCGTGATCATGGAGTTCGGCGTCCGGTTC
GGCCGTCACCTCGGCACGTTCGCCGCCCTGCGCGGTGTCTACGAGCCCTACAACCCGCTG
CGCCGCATCGTCGGCTTCGACACCTTCACCGGCTTCCCCGACGTCAACGACGTCGACCGC
GTCGGCCCCACGGCGTACCAGGGCCGCTTCGCAGTGCCCGGGGGCTATCCGGCGTACCTG
AAAGAGGTGCTGGACGCGCACGAGTGCAGCGACTTCTTCGGCCACGTGACGCAGCGCAGC
GTGCTCGTCGAGGGGGACGTACGGGAGACGGTGCCGCGCTACCTCGCGGAGAACCCGCAG
ACCGTCATCGCGCTGGCGTACTTCGACCTCGACCTCTACGAGCCGACGAAGGCCGTCCTG
GAGGCGATCCGCCCCTACCTCACCAAGGGCAGCATCGTCGCCTTCGACGAACTCGACAAT
CCGAAGTGGCCCGGCGAGAACATCGCGATGCGGAAGGTGCTCGGGCTGGACCACGCCCCG
CTGCGCCTGCTGCCGGGCCGCCCGGCGCCGGCGTACCTGCGGTGGGGCGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR008884 Macrocin-O-methyltransferase (Family)
 [62-218]  7.3e-06 PF05711
PF05711   TylF
SignalP No significant hit
TMHMM No significant hit