close all open/close all

CDS information : Calm_00470


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction55,857 / 56,402 / + [in whole cluster]
55,857 / 56,402 / + [in contig]
Location55857..56402 [in whole cluster]
55857..56402 [in contig]
TypeCDS
Length546 bp (181 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.4 resistance
Productcalicheamicin resistance protein
Product (GenBank)CalC
Gene
Gene (GenBank)calC
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)
[12970566] Resistance to enediyne antitumor antibiotics by CalC self-sacrifice. (Science. , 2003)
[17168523] Structural insight into the self-sacrifice mechanism of enediyne resistance. (ACS Chem Biol. , 2006)

close this sectionSequence

selected fasta
>calicheamicin resistance protein [CalC]
MTQEKTAPAAKSTTTKSTAAKKPKPPNYDPFVRHSVTVKADRKTAFKTFLEGFPEWWPNN
FRTTKVGAPLGVDKKGGRWYEIDEQGEEHTFGLIRKVDEPDTLVIGWRLNGFGRIDPDNS
SEFTVTFVADGQKKTRVDVEHTHFDRMGTKHAKRVRNGMDKGWPTILQSFQDKIDEEGAK
K
selected fasta
>calicheamicin resistance protein [CalC]
ATGACTCAGGAGAAGACCGCACCGGCCGCGAAGAGCACGACCACCAAGAGCACCGCCGCG
AAGAAGCCGAAGCCCCCGAACTACGACCCGTTCGTCCGGCACAGCGTCACTGTCAAGGCC
GACCGCAAGACCGCCTTCAAGACGTTCCTCGAAGGCTTTCCGGAGTGGTGGCCGAACAAC
TTCCGCACCACCAAGGTCGGGGCCCCGCTGGGCGTCGACAAGAAGGGCGGCCGCTGGTAC
GAGATCGACGAGCAGGGCGAGGAGCACACCTTCGGCCTGATCCGGAAGGTGGACGAGCCG
GACACGCTGGTCATCGGCTGGCGGCTCAACGGCTTCGGCCGGATCGACCCGGACAACTCG
AGCGAGTTCACCGTGACCTTCGTGGCCGACGGCCAGAAGAAGACCCGGGTGGACGTCGAG
CACACCCACTTCGACCGGATGGGCACCAAGCACGCCAAGCGGGTCCGCAACGGCATGGAC
AAGGGCTGGCCGACGATCCTCCAGTCGTTCCAGGACAAGATCGACGAGGAAGGGGCGAAG
AAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013538 Activator of Hsp90 ATPase homologue 1-like (Family)
 [51-171]  1.1e-11 PF08327
PF08327   AHSA1
IPR023393 START-like domain (Domain)
 [32-172]  1.6e-13 G3DSA:3.30.530.20
G3DSA:3.30.530.20   G3DSA:3.30.530.20
SignalP No significant hit
TMHMM No significant hit