close all open/close all

CDS information : Calm_00490


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction58,108 / 57,266 / - [in whole cluster]
58,108 / 57,266 / - [in contig]
Locationcomplement(57266..58108) [in whole cluster]
complement(57266..58108) [in contig]
TypeCDS
Length843 bp (280 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative drug resistance ABC transporter permease protein
Product (GenBank)CalT4
Gene
Gene (GenBank)calT4
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)
Related Reference
ACC
O86917
PmId
[9696745] A silent ABC transporter isolated from Streptomyces rochei F20 induces multidrug resistance. (J Bacteriol. , 1998)
ACC
P32011
NITE
Adria_00140
PmId
[1924314] A bacterial analog of the mdr gene of mammalian tumor cells is present in Streptomyces peucetius, the producer of daunorubicin and doxorubicin. (Proc Natl Acad Sci U S A. , 1991)
[9006006] Expression and characterization of DrrA and DrrB proteins of Streptomyces peucetius in Escherichia coli: DrrA is an ATP binding protein. (J Bacteriol. , 1997)
[15709779] Biochemical characterization of domains in the membrane subunit DrrB that interact with the ABC subunit DrrA: identification of a conserved motif. (Biochemistry. , 2005)
[19063901] Translational coupling controls expression and function of the DrrAB drug efflux pump. (J Mol Biol. , 2009)
[20158521] Daunorubicin efflux in Streptomyces peucetius modulates biosynthesis by feedback regulation. (FEMS Microbiol Lett. , 2010)

close this sectionSequence

selected fasta
>putative drug resistance ABC transporter permease protein [CalT4]
MTTPSTEVRPLPAEIFSRSVAGAERPPRPGPLFAVRTFAWRNLIKLRYVQDHLGTAVVFP
IILTLVFTYLLGGAIAGSPREYLQFFLPGVIVLSLVSSSMMSALTLNRDIATGMFDRVRS
TPIWQPAVLVGAMAGDAVRYALTSIVPLSLGLLLGFRPDGGLSGVVLALLYLQLFTFSVA
WLWMLFAVLIPQPTAAAGVVNLLQFVLLFGSNILAPSQTMPGWLEAVVKLNPVTHAATAT
RGLMHGTVTSGEMGAGLLTCAVLIVLLAPPTIWLYSRKQR
selected fasta
>putative drug resistance ABC transporter permease protein [CalT4]
ATGACGACACCCAGCACCGAGGTGCGGCCGCTGCCGGCCGAGATCTTCAGCCGATCGGTG
GCCGGCGCGGAACGGCCGCCACGCCCCGGCCCGCTGTTCGCCGTCCGCACCTTCGCCTGG
CGGAACCTGATCAAGCTCCGGTACGTGCAGGACCACCTGGGCACCGCGGTGGTCTTCCCG
ATCATCCTGACGCTGGTCTTCACCTATCTGCTCGGCGGCGCGATCGCCGGCTCGCCCCGG
GAGTACCTGCAGTTCTTCCTTCCCGGCGTGATCGTCCTCTCGCTCGTGTCGTCGAGCATG
ATGAGCGCCCTGACGCTGAACCGGGACATCGCCACCGGCATGTTCGACCGGGTCCGCAGC
ACGCCCATCTGGCAGCCCGCGGTACTGGTCGGGGCGATGGCCGGCGACGCCGTCCGGTAC
GCCCTGACCTCGATCGTGCCGCTGTCGCTCGGCCTGCTGCTCGGCTTCCGGCCGGACGGC
GGCCTGTCCGGGGTGGTGCTCGCCCTGCTCTACCTGCAGCTGTTCACCTTCAGCGTCGCC
TGGCTGTGGATGCTGTTCGCGGTGCTGATCCCGCAGCCGACCGCCGCCGCCGGCGTGGTG
AACCTCCTGCAGTTCGTGCTCCTCTTCGGCAGCAACATCCTGGCGCCGTCGCAGACGATG
CCGGGCTGGCTGGAGGCGGTGGTCAAGTTGAACCCCGTCACCCACGCCGCGACCGCCACC
CGCGGGCTGATGCACGGCACGGTGACCTCGGGGGAGATGGGCGCCGGCCTGCTGACCTGC
GCCGTGCTCATCGTGCTGCTCGCCCCGCCCACGATCTGGCTCTACAGCCGCAAGCAGCGC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000412 ABC-2 (Family)
 [51-278]  PS51012
PS51012   ABC_TM2
IPR013525 ABC-2 type transporter (Domain)
 [36-244]  7.5e-23 PF01061
PF01061   ABC2_membrane
SignalP No significant hit
TMHMM
 [53-75]  Transmembrane (i-o) [85-107]  Transmembrane (o-i) [128-150]  Transmembrane (i-o) [165-187]  Transmembrane (o-i) [194-216]  Transmembrane (i-o) [253-275]  Transmembrane (o-i)
Transmembrane 6