close all open/close all

CDS information : Calm_00510


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction60,914 / 59,208 / - [in whole cluster]
60,914 / 59,208 / - [in contig]
Locationcomplement(59208..60914) [in whole cluster]
complement(59208..60914) [in contig]
TypeCDS
Length1,707 bp (568 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative transporter
Product (GenBank)CalT6
Gene
Gene (GenBank)calT6
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)
Related Reference
ACC
P26906
PmId
[1766370] A Bacillus subtilis dipeptide transport system expressed early during sporulation. (Mol Microbiol. , 1991)
Family/Domain
FD
IPR000914

close this sectionSequence

selected fasta
>putative transporter [CalT6]
MPDHDQQPRHGGTLRYYGPGGLDHLDPAAAYYAFSHQVIRLFARQLFSYPTTEDAAALVP
VPDVAAELPTVDNGGLSEDGRTYTIRLRDGVRWDTAPPRPVTAGDFVRGFKRMANPVAGA
GAIAYYTSTIAGMAEFAEGYRARFAGRTPTAAELADYQNGHEISGLWAKDDRTLVIELLR
PANDMLNLLAMPFASAAPREFDDLVPDGPDFARLVRSNGPYRITGYARGSHLTMDHNPAW
RADADPIRRRYVDRIEVRMARVSDERVRAEIESGAADLSWGAAVGRPRRRTAADRNLGWA
LNPYLAFNLHSPHERGALRDRTVRLAIAYAVDKARLVRFFDDMNIGTVTRPAHTAIPPGN
FGHREYDPYPTPGDRGDRARCRELLAEAGYPDGLRLTMIYRIDAVHGQVAKAIAEDLGAG
GVDVRLVEIDQTDEYYRILQDPARAAAGEWDITPAAWMPDWFGNNGRSYVQPMFQSNTGV
GTANYGGYHNPLVDELIDRALSARTEAEAEELWHRVDRQVLQDVAIVPILACEPTIEHLT
SSRVRGAIPLPHVDRWYDAANLWLDPPD
selected fasta
>putative transporter [CalT6]
GTGCCGGACCACGACCAGCAGCCTCGCCACGGCGGCACGCTGCGCTACTACGGGCCCGGT
GGCCTCGACCACCTGGACCCCGCCGCCGCGTACTACGCCTTCTCCCACCAGGTCATCCGG
CTCTTCGCCCGGCAGCTGTTCAGCTACCCGACCACGGAGGACGCCGCCGCGCTGGTGCCG
GTGCCCGACGTGGCCGCCGAGTTGCCCACGGTGGACAATGGCGGGCTCAGCGAGGACGGC
CGCACGTACACGATCCGCCTGCGCGACGGGGTCCGGTGGGACACCGCCCCGCCGCGGCCG
GTGACCGCGGGGGACTTCGTGCGCGGCTTCAAGCGGATGGCCAACCCGGTCGCCGGGGCC
GGCGCCATCGCCTACTACACGAGCACCATCGCCGGCATGGCGGAGTTCGCCGAGGGCTAC
CGCGCGCGCTTCGCCGGGCGTACGCCCACCGCCGCCGAGCTGGCCGACTACCAGAACGGC
CACGAGATCAGCGGGCTGTGGGCCAAGGACGACCGGACCCTGGTGATCGAGCTGCTGCGC
CCCGCCAACGACATGCTCAACCTGCTGGCGATGCCGTTCGCCTCCGCCGCGCCCCGGGAG
TTCGACGACCTCGTCCCGGACGGTCCGGACTTCGCGCGGCTGGTCCGCTCCAACGGGCCG
TACCGGATCACCGGCTACGCCCGGGGCAGCCACCTGACCATGGACCACAACCCCGCCTGG
CGGGCCGACGCAGACCCGATCCGCCGCCGCTACGTGGACCGTATCGAGGTGCGGATGGCG
AGGGTGAGCGACGAGCGGGTCCGCGCCGAGATCGAGAGCGGGGCGGCCGACCTGTCGTGG
GGCGCCGCCGTGGGCAGGCCCCGCCGGCGTACGGCGGCCGACCGGAACCTCGGCTGGGCG
CTGAACCCCTACCTGGCGTTCAACCTGCACAGCCCGCACGAGCGGGGGGCGCTGCGCGAC
CGGACCGTCCGGCTGGCGATCGCGTACGCCGTCGACAAGGCGCGGCTCGTCCGGTTCTTC
GACGACATGAACATCGGCACGGTGACCCGCCCCGCGCACACGGCCATCCCGCCGGGCAAC
TTCGGCCACCGCGAGTACGACCCGTACCCGACGCCGGGGGACCGGGGCGACCGGGCGCGC
TGCCGGGAGCTGCTCGCCGAGGCCGGGTACCCCGACGGGCTGCGGCTCACCATGATCTAC
CGGATCGACGCGGTGCACGGCCAGGTGGCCAAGGCGATCGCCGAGGACCTGGGCGCGGGC
GGCGTCGACGTCCGGCTGGTCGAGATCGACCAGACCGACGAGTACTACCGCATCCTCCAG
GACCCGGCCCGCGCGGCGGCGGGGGAGTGGGACATCACGCCGGCCGCCTGGATGCCGGAC
TGGTTCGGCAACAACGGGCGGTCGTACGTCCAGCCGATGTTCCAGTCCAACACCGGCGTC
GGCACGGCCAACTACGGCGGCTACCACAACCCGCTCGTCGACGAGCTGATCGACCGCGCG
TTGTCCGCCCGGACGGAGGCCGAGGCGGAGGAGCTGTGGCACCGGGTCGACCGGCAGGTG
CTGCAGGACGTGGCGATCGTGCCGATCCTGGCCTGCGAGCCGACCATCGAGCACCTGACC
AGTTCCCGGGTGCGGGGGGCGATCCCGCTGCCGCACGTGGACCGCTGGTACGACGCGGCG
AACCTCTGGCTGGACCCGCCCGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000914 Bacterial extracellular solute-binding protein, family 5 (Domain)
 [61-465]  3.40000000000004e-50 PF00496
PF00496   SBP_bac_5
SignalP No significant hit
TMHMM No significant hit