close all open/close all

CDS information : Calm_00520


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction61,975 / 60,938 / - [in whole cluster]
61,975 / 60,938 / - [in contig]
Locationcomplement(60938..61975) [in whole cluster]
complement(60938..61975) [in contig]
TypeCDS
Length1,038 bp (345 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Productputative C-3 O-methyltransferase
Product (GenBank)CalO1
Gene
Gene (GenBank)calO1
EC number2.1.1.-
Keyword
  • orsellinic acid moiety
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)
[21358050] Structural characterization of CalO1: a putative orsellinic acid methyltransferase in the calicheamicin-biosynthetic pathway. (Acta Crystallogr D Biol Crystallogr. , 2011)

close this sectionSequence

selected fasta
>putative C-3 O-methyltransferase [CalO1]
MQRQRPPSRAGGDMDRLQSALALYEEAMGYTYAAALRAAAAVGVADHLVDGPRTPAELAA
ATGTDADALRRVLRLLAVRDVVRESDGRFALTDKGAALRSDSPVPARAGILMFTDTMFWT
MSHRVASALGPERPAFADIFGSSLDAYFDGDAEVEALYYEGMETVSAAEHLILARAGDFP
ATGTVADVGGGRGGFLLTVLREHPGLQGVLLDRAEVVARHRLDAPDVAGRWKVVEGDFLR
EVPHADVHVLKRILHNWGDEDSVRILTNCRRVMPAHGRVLVIDAVVPEGNDAHQSKEMDF
MMLAARTGQERTAAELEPLFTAAGLRLDRVVGTSSVMSIAVGVPA
selected fasta
>putative C-3 O-methyltransferase [CalO1]
GTGCAGCGGCAGCGTCCGCCATCACGGGCCGGAGGGGACATGGACAGGTTGCAGTCGGCG
CTGGCCCTCTACGAGGAGGCGATGGGCTACACGTACGCGGCAGCCCTGCGGGCCGCCGCC
GCCGTCGGCGTCGCCGACCACCTGGTCGACGGCCCCCGTACGCCCGCCGAGCTGGCCGCC
GCGACGGGCACCGACGCGGACGCGCTCCGCCGGGTGCTGCGCCTGCTGGCGGTCCGCGAC
GTGGTCCGCGAGTCCGACGGCCGGTTCGCGCTGACCGACAAGGGCGCGGCGCTGCGGTCG
GACTCGCCGGTGCCCGCGCGGGCCGGCATCCTCATGTTCACCGACACGATGTTCTGGACG
ATGAGTCACCGGGTGGCGAGCGCGCTGGGGCCGGAGCGACCCGCCTTCGCCGACATCTTC
GGTAGCTCGCTGGACGCCTACTTCGACGGCGACGCCGAGGTCGAGGCGCTCTACTACGAG
GGCATGGAAACGGTCAGCGCGGCGGAGCACCTCATTCTCGCCCGCGCCGGTGACTTCCCC
GCCACCGGCACCGTGGCGGACGTCGGCGGCGGCCGGGGCGGCTTCCTGCTCACCGTCCTA
CGCGAGCACCCCGGCCTGCAGGGCGTGCTGCTGGACCGCGCGGAGGTGGTCGCCCGGCAC
CGGCTGGACGCCCCGGACGTGGCGGGGCGCTGGAAGGTTGTCGAGGGCGACTTCCTCCGC
GAGGTGCCCCACGCCGACGTGCACGTGCTCAAGCGCATCCTGCACAACTGGGGCGACGAG
GACAGCGTCCGGATCCTGACGAACTGCCGCCGGGTCATGCCCGCGCACGGCCGGGTGCTC
GTGATCGACGCGGTCGTCCCCGAGGGCAACGACGCGCACCAGAGCAAGGAGATGGACTTC
ATGATGCTCGCCGCGCGCACCGGCCAGGAACGCACCGCCGCCGAGCTGGAGCCGTTGTTC
ACCGCGGCCGGGCTGCGCCTGGACCGGGTCGTCGGCACCTCGTCGGTCATGTCCATCGCG
GTCGGCGTGCCGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001077 O-methyltransferase, family 2 (Domain)
 [86-320]  2.19999999999997e-54 PF00891
PF00891   Methyltransf_2
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [23-95]  2.4e-16 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016461 O-methyltransferase, caffeic acid-type (Family)
 [1-344]  1.60000240695997e-24 PIRSF005739
PIRSF005739   O-mtase
SignalP No significant hit
TMHMM No significant hit