close all open/close all

CDS information : Calm_00530


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction62,177 / 63,463 / + [in whole cluster]
62,177 / 63,463 / + [in contig]
Location62177..63463 [in whole cluster]
62177..63463 [in contig]
TypeCDS
Length1,287 bp (428 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative aminotransferase
Product (GenBank)CalE9
Gene
Gene (GenBank)calE9
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)
Family/Domain
FD
IPR000192

close this sectionSequence

selected fasta
>putative aminotransferase [CalE9]
MSASPAQSPLRTASWARIRELFALDPTTVHLNTGTVGAMPYEVLDTVDRVTRQWTGGLLD
VYRPAMFTEYRDAIAKTFGVDGDEIVICHNATEGVARVIHGLDLREGDEVVTTTHECYSV
LSNFNLLRNRFGVVLKTVTPPSGHEVRAEEIVELVEAAITPRTKVLSFAAITLFTGTMFP
IRQLCELAHRHGLTTVIDGALIPGMLDCDLRATGADFITCSGSKFQCGPLGTGLIYVRNK
VVPEHNPLPLPTFWPLISTWYPMMGSPPPRTSTAVESYNMGDFLQSAGSANLARGAALAR
AFELWDDIGRDRIEAYIMDLAEYARGRLIDAFGVEAMYSPGADPRLRSPLLAFNPFRRPE
DAWNIKKFIGFVKRLETEHRIWTRWTEFDVPGSPHQHYAARITTHLFNTREEIDHTVRTM
VRLAEEMS
selected fasta
>putative aminotransferase [CalE9]
GTGTCGGCGTCACCGGCGCAGAGTCCGCTGCGCACCGCGTCCTGGGCCCGCATCCGCGAG
CTGTTCGCCCTGGACCCGACGACCGTGCACCTCAACACGGGGACGGTCGGCGCCATGCCG
TACGAGGTGCTGGACACCGTGGACCGGGTGACCCGCCAGTGGACCGGCGGCCTGCTCGAC
GTCTACCGCCCGGCGATGTTCACCGAGTACCGGGACGCCATCGCGAAGACGTTCGGCGTG
GACGGCGACGAGATCGTGATCTGCCACAACGCCACCGAGGGGGTCGCCCGGGTCATCCAC
GGCCTCGACCTGCGCGAGGGCGACGAGGTGGTGACGACCACGCACGAGTGCTACTCCGTG
CTGTCCAACTTCAACCTGCTGCGCAACCGGTTCGGGGTGGTGCTGAAGACCGTCACCCCG
CCGTCCGGCCACGAGGTGCGCGCGGAGGAGATCGTCGAGCTGGTCGAGGCCGCCATCACG
CCCCGGACGAAGGTGCTCTCGTTCGCCGCGATCACCCTCTTCACCGGGACGATGTTCCCC
ATCCGGCAGCTCTGCGAGCTGGCGCACCGGCACGGGCTGACCACCGTCATCGACGGCGCG
CTGATCCCCGGCATGCTCGACTGCGACCTGCGCGCGACCGGGGCGGACTTCATCACCTGC
TCCGGGTCGAAGTTCCAGTGCGGCCCGCTCGGCACCGGCCTGATCTACGTCCGCAACAAG
GTCGTCCCCGAGCACAACCCCCTGCCGCTGCCCACGTTCTGGCCGCTCATCTCGACCTGG
TACCCGATGATGGGCAGCCCGCCGCCGCGGACCAGCACCGCCGTGGAGAGCTACAACATG
GGCGACTTCCTGCAGAGCGCCGGCAGCGCCAACCTGGCGCGGGGCGCCGCCCTGGCCCGG
GCCTTCGAGCTGTGGGACGACATCGGCCGCGACCGCATCGAGGCGTACATCATGGACCTC
GCCGAGTACGCCCGCGGCCGGCTCATCGACGCGTTCGGCGTCGAGGCCATGTACTCCCCC
GGCGCCGACCCGCGGCTGCGCTCGCCGCTGCTCGCGTTCAACCCGTTCCGGCGGCCGGAG
GACGCCTGGAACATCAAGAAGTTCATCGGCTTCGTCAAGCGCCTGGAGACCGAGCACCGG
ATCTGGACCCGCTGGACGGAGTTCGACGTGCCCGGCTCCCCGCACCAGCACTACGCGGCG
CGCATCACCACGCACCTGTTCAACACCCGGGAAGAGATCGACCACACCGTACGGACGATG
GTCCGCCTGGCCGAGGAGATGTCTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000192 Aminotransferase, class V/Cysteine desulfurase (Domain)
 [63-338]  1.40000000000001e-37 PF00266
PF00266   Aminotran_5
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [64-298]  7.00000000000005e-44 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [299-426]  2.9e-09 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [13-428]  2.1000026783403e-66 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP No significant hit
TMHMM No significant hit