close all open/close all

CDS information : Calm_00540


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction64,685 / 63,477 / - [in whole cluster]
64,685 / 63,477 / - [in contig]
Locationcomplement(63477..64685) [in whole cluster]
complement(63477..64685) [in contig]
TypeCDS
Length1,209 bp (402 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative transposase
Product (GenBank)IS
Gene
Gene (GenBank)IS
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)
Family/Domain
FD
IPR001959, IPR010095, IPR021027

close this sectionSequence

selected fasta
>putative transposase [IS]
MRTAYRCRAYPTPEQAAVLNRTFGCVRVVWNRTLAARHARWHTERRSTSYAETDRALTEM
KKQPDLAYLGEVSSVPLQQTLRHQHTAMTAFFAKRARYPRYKSRHGRQSASYTRSAFRLR
SGNLSLGKTPGVLRFVWSLPNVDPAGLDPTMVTVSRDPDGRWFVTFAVDVDTPAAPEPTG
EAVGVDLGLTDFAVLSTGERIPHPKHMERRERRLKRYQRIMARRQKGSANRAKAKRMVAR
AHSQVRDARRDFLHQQSTALVRRFAAIAVEDLAVANMVRNHSLAKAISRTGWAEFRTLLT
YKAHRDGRTLAVVDRWYPSSKTCSACGHLLATLSLGTRHWTCPSCGTRHDRDVNAAKNIT
VAAGLAETKNACGADVRHEGPPSVRSAVNQEPQPARVGLPRL
selected fasta
>putative transposase [IS]
GTGCGGACGGCGTACAGGTGTCGGGCGTACCCGACCCCGGAGCAGGCGGCGGTGCTGAAC
CGCACGTTCGGGTGTGTACGTGTCGTCTGGAACCGCACGCTCGCCGCCCGTCACGCCCGC
TGGCACACCGAACGGAGATCCACCTCCTACGCGGAGACCGATCGGGCGTTGACGGAGATG
AAGAAGCAGCCCGACCTGGCGTATCTGGGTGAGGTGTCGTCGGTGCCGTTGCAGCAGACC
CTGCGGCACCAGCACACCGCCATGACCGCCTTCTTCGCCAAGCGGGCCCGGTACCCGCGC
TACAAGTCCCGACACGGCCGCCAGTCCGCCAGTTACACCCGGTCGGCGTTCCGCCTCCGC
AGCGGGAACCTGTCGTTGGGAAAGACACCCGGGGTGCTGCGGTTCGTGTGGTCGTTGCCG
AACGTGGATCCGGCGGGGTTGGATCCGACGATGGTGACGGTGTCGCGTGACCCGGACGGC
CGCTGGTTCGTGACCTTCGCCGTCGACGTCGACACACCCGCCGCACCCGAACCCACCGGC
GAGGCGGTGGGCGTGGACCTCGGCCTGACCGACTTCGCGGTGCTGTCCACCGGCGAACGC
ATCCCCCACCCGAAGCACATGGAACGGCGGGAACGCCGACTCAAGCGGTATCAGCGGATA
ATGGCCCGCCGACAGAAGGGCTCCGCCAACCGCGCCAAAGCCAAACGAATGGTCGCCCGA
GCGCATTCGCAGGTGCGCGACGCCCGCCGGGACTTCCTCCACCAGCAGTCCACCGCCCTG
GTGCGCCGGTTCGCCGCCATCGCCGTGGAGGACCTGGCCGTGGCGAACATGGTCCGCAAC
CACTCCCTGGCCAAAGCGATCTCGCGTACCGGCTGGGCCGAGTTCCGCACCCTGCTCACC
TACAAGGCGCACCGCGACGGCCGCACCCTCGCGGTGGTGGACCGCTGGTACCCGTCGTCG
AAGACCTGCTCGGCGTGCGGGCACCTGCTCGCCACACTCTCCCTCGGCACACGCCACTGG
ACGTGTCCGAGTTGCGGCACCCGGCATGACCGGGACGTCAACGCAGCCAAGAACATCACC
GTCGCGGCCGGGCTGGCCGAGACGAAAAACGCCTGCGGAGCGGACGTCAGACACGAAGGA
CCTCCTTCCGTGCGGTCTGCGGTGAACCAGGAACCCCAACCCGCGAGGGTCGGACTCCCC
CGCCTTTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001959 Transposase, probable, IS891/IS1136/IS1341 (Domain)
 [70-278]  3.40000000000004e-42 PF01385
PF01385   OrfB_IS605
IPR010095 Transposase IS605, OrfB, C-terminal (Domain)
 [292-360]  1.6e-23 PF07282
PF07282   OrfB_Zn_ribbon
 [246-319]  1.2e-12 TIGR01766
TIGR01766   TspaseT_teng_C
IPR021027 Transposase, putative, helix-turn-helix domain (Domain)
 [1-45]  4.5e-17 PF12323
PF12323   HTH_OrfB_IS605
SignalP No significant hit
TMHMM No significant hit