close all open/close all

CDS information : Calm_00570


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction68,981 / 67,788 / - [in whole cluster]
68,981 / 67,788 / - [in contig]
Locationcomplement(67788..68981) [in whole cluster]
complement(67788..68981) [in contig]
TypeCDS
Length1,194 bp (397 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productglycosyltransferase
Product (GenBank)CalG2
Gene
Gene (GenBank)calG2
EC number
Keyword
  • 4-thio-2,4,6-trideoxy-D-glucose
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)
[18721755] Biochemical and structural insights of the early glycosylation steps in calicheamicin biosynthesis. (Chem Biol. , 2008)

close this sectionSequence

selected fasta
>glycosyltransferase [CalG2]
MAHLLIVNVASHGLILPTLTVVTELVRRGHRVSYVTAGGFAEPVRAAGATVVPYQSEIID
ADAAEVFGSDDLGVRPHLMYLRENVSVLRATAEALDGDVPDLVLYDDFPFIAGQLLAARW
RRPAVRLSAAFASNEHYSFSQDMVTLAGTIDPLDLPVFRDTLRDLLAEHGLSRSVVDCWN
HVEQLNLVFVPKAFQIAGDTFDDRFVFVGPCFDDRRFLGEWTRPADDLPVVLVSLGTTFN
DRPGFFRDCARAFDGQPWHVVMTLGGQVDPAALGDLPPNVEAHRWVPHVKVLEQATVCVT
HGGMGTLMEALYWGRPLVVVPQSFDVQPMARRVDQLGLGAVLPGEKADGDTLLAAVGAVA
ADPALLARVEAMRGHVRRAGGAARAADAVEAYLARAR
selected fasta
>glycosyltransferase [CalG2]
ATGGCCCACCTCCTGATCGTCAACGTCGCCAGCCACGGCCTGATCCTGCCCACCCTCACC
GTGGTCACCGAGCTGGTCCGGCGCGGGCACCGGGTCAGCTACGTCACCGCCGGCGGGTTC
GCGGAGCCGGTCCGTGCCGCCGGCGCGACGGTGGTGCCCTACCAGTCGGAGATCATCGAC
GCGGACGCCGCCGAGGTGTTCGGCTCGGACGACCTCGGCGTCCGTCCCCACCTGATGTAC
CTGCGGGAGAACGTCTCGGTGCTCCGGGCCACCGCCGAGGCGCTCGACGGCGACGTGCCG
GACCTGGTCCTCTACGACGACTTCCCGTTCATCGCCGGGCAGTTGCTGGCCGCCCGCTGG
CGGCGGCCGGCCGTCCGGCTCAGCGCGGCGTTCGCGTCGAACGAGCACTACTCGTTCTCC
CAGGACATGGTCACCCTGGCCGGCACGATCGACCCGCTCGACCTGCCGGTGTTCCGCGAC
ACCCTGCGGGACCTGCTCGCCGAGCACGGCCTGTCCCGGTCGGTCGTGGACTGCTGGAAC
CACGTGGAGCAACTCAACCTGGTCTTCGTCCCGAAGGCGTTCCAGATCGCCGGCGACACC
TTCGACGACCGCTTCGTCTTCGTCGGGCCGTGCTTCGACGACCGGCGGTTCCTCGGCGAG
TGGACCCGCCCGGCCGACGACCTGCCGGTGGTGCTGGTGTCGCTCGGCACCACCTTCAAC
GACCGGCCCGGATTCTTCCGCGACTGCGCGCGGGCGTTCGACGGCCAGCCGTGGCACGTG
GTGATGACGCTGGGCGGCCAGGTCGACCCGGCGGCTCTCGGCGACCTGCCCCCCAACGTG
GAGGCGCACCGCTGGGTCCCGCACGTGAAGGTGCTCGAACAGGCGACGGTCTGCGTGACG
CACGGCGGCATGGGCACCCTCATGGAGGCGCTCTACTGGGGGCGCCCGCTGGTGGTCGTG
CCGCAGTCCTTCGACGTGCAGCCGATGGCCCGGCGGGTCGACCAGCTCGGCCTCGGCGCG
GTGCTGCCCGGGGAGAAGGCCGACGGCGACACGCTGCTCGCCGCCGTCGGGGCCGTCGCG
GCCGACCCCGCGCTGCTCGCCCGGGTCGAGGCCATGCGGGGCCACGTCCGCCGGGCCGGG
GGCGCGGCCCGGGCCGCCGACGCCGTGGAGGCGTACCTGGCCCGCGCCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002213 UDP-glucuronosyl/UDP-glucosyltransferase (Family)
 [225-363]  8.10000000000001e-10 PF00201
PF00201   UDPGT
IPR006326 UDP-glycosyltransferase, MGT (Family)
 [8-395]  4.69999999999992e-118 TIGR01426
TIGR01426   MGT
SignalP
 [1-20]  0.495 Signal
Eukaryota   
TMHMM No significant hit