close all open/close all

CDS information : Calm_00580


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction70,024 / 69,032 / - [in whole cluster]
70,024 / 69,032 / - [in contig]
Locationcomplement(69032..70024) [in whole cluster]
complement(69032..70024) [in contig]
TypeCDS
Length993 bp (330 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-sugar C-3 ketoreductase
Product (GenBank)CalS12
Gene
Gene (GenBank)calS12
EC number
Keyword
  • aminodideoxypentose
  • axial-OH
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)
[19058170] Natural-product sugar biosynthesis and enzymatic glycodiversification. (Angew Chem Int Ed Engl. , 2008)
Related Reference
ACC
Q9XC70
PmId
[16448097] A two-stage one-pot enzymatic synthesis of TDP-L-mycarose from thymidine and glucose-1-phosphate. (J Am Chem Soc. , 2006)

close this sectionSequence

selected fasta
>putative NDP-sugar C-3 ketoreductase [CalS12]
MSSLHVRLGRTGLRVSRVAIGTVNFGGRVDEADAHRLLDHAVAQGVNLVDTADIYGWRVH
RGWTEEMIGRWLAKDPARRDEVVLATKVGNPMGDGPNARGLSARHVVAACEASLRRLQTD
AIDLYQMHHVDREVGWDEIWQAMEQLVRQGKVRYVGSSNFAGWDLVSAQEAARRHRLLGL
ASEQCVYNLVSRYVELEVLPAAVAEGIGVLVWSPLHGGLLGGVLRKLADGTAVKSAQGRA
AEAVERHRATLAAYETFCAEAGRDPAEVGMAWVLHRPAVTAAVVGPRTPEHLDGALRALH
RPLSAAELARLDELFPPLGRGGAAPDAWMS
selected fasta
>putative NDP-sugar C-3 ketoreductase [CalS12]
GTGTCGTCGCTGCATGTCCGGCTCGGACGGACCGGCCTGCGGGTCAGCCGGGTCGCCATC
GGGACCGTCAACTTCGGCGGCCGGGTCGACGAGGCCGACGCCCACCGGCTGCTCGACCAC
GCCGTCGCGCAGGGGGTCAACCTGGTCGACACCGCCGACATCTACGGCTGGCGGGTGCAC
CGGGGCTGGACCGAGGAGATGATCGGGCGCTGGCTCGCCAAGGACCCGGCCCGGCGGGAC
GAGGTGGTCCTCGCGACCAAGGTCGGCAATCCCATGGGGGACGGCCCCAACGCCCGGGGC
CTGTCGGCCCGACACGTCGTCGCCGCCTGCGAGGCGTCGCTGCGCCGGCTCCAGACCGAC
GCCATCGACCTCTACCAGATGCACCACGTCGACCGGGAGGTCGGCTGGGACGAGATCTGG
CAGGCCATGGAGCAGCTCGTCCGGCAGGGCAAGGTCCGCTACGTCGGGTCCTCGAACTTC
GCCGGCTGGGACCTGGTGAGCGCCCAGGAGGCCGCGCGCCGGCACCGGCTGCTCGGGCTG
GCCAGCGAGCAGTGCGTCTACAACCTGGTCAGCCGGTACGTCGAACTGGAGGTGCTCCCC
GCCGCCGTCGCCGAGGGCATCGGGGTGCTCGTCTGGTCGCCGCTGCACGGCGGGCTGCTC
GGCGGCGTGCTGCGGAAGCTGGCCGACGGCACCGCGGTCAAGTCCGCGCAGGGACGGGCC
GCCGAGGCGGTCGAGCGGCACCGCGCGACACTCGCCGCGTACGAGACGTTCTGCGCCGAG
GCCGGCCGCGACCCGGCGGAGGTCGGCATGGCCTGGGTGCTGCACCGCCCGGCGGTGACC
GCCGCGGTCGTCGGTCCGCGTACCCCCGAACACCTGGACGGCGCCCTGCGGGCCCTGCAC
CGGCCGCTGTCGGCGGCGGAGCTCGCCCGGCTCGACGAGCTGTTCCCGCCGCTCGGCCGG
GGCGGCGCCGCCCCGGACGCCTGGATGTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR023210 NADP-dependent oxidoreductase domain (Domain)
 [1-317]  2.19999900980707e-90 SSF51430
SSF51430   Aldo/ket_red
 [18-315]  2.90000000000003e-69 PF00248
PF00248   Aldo_ket_red
 [6-315]  1.79999999999997e-90 G3DSA:3.20.20.100
G3DSA:3.20.20.100   Aldo/ket_red
SignalP No significant hit
TMHMM No significant hit