close all open/close all

CDS information : Calm_00590


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction70,221 / 71,351 / + [in whole cluster]
70,221 / 71,351 / + [in contig]
Location70221..71351 [in whole cluster]
70221..71351 [in contig]
TypeCDS
Length1,131 bp (376 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductNDP-sugar C-4 aminotransferase
Product (GenBank)CalS13
Gene
Gene (GenBank)calS13
EC number2.6.1.-
Keyword
  • aminodideoxypentose
  • 4-hydroxyamino-6-deoxy-alpha-D-glucose
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)
[16873021] Deciphering indolocarbazole and enediyne aminodideoxypentose biosynthesis through comparative genomics: insights from the AT2433 biosynthetic locus. (Chem Biol. , 2006)
[19058170] Natural-product sugar biosynthesis and enzymatic glycodiversification. (Angew Chem Int Ed Engl. , 2008)
[24911465] A general NMR-based strategy for the in situ characterization of sugar-nucleotide-dependent biosynthetic pathways. (Org Lett. , 2014)
[26023720] Structural Basis for the Stereochemical Control of Amine Installation in Nucleotide Sugar Aminotransferases. (ACS Chem Biol. , 2015)

close this sectionSequence

selected fasta
>NDP-sugar C-4 aminotransferase [CalS13]
MIPLSKVAMSPDVSTRVSAVLSSGRLEHGPTVAEYEAAVGSRIGNPRVVSVNCGTAGLHL
ALSLAARPGAGESEHDGPGEVLTTPLTFEGTNWPILANGLRIRWVDVDPATLNMDLDDLA
AKISPATRAIVVVHWLGYPVDLNRLRAVVDRATAGYDRRPLVVEDCAQAWGATYRGAPLG
THGNVCVYSTGAIKILTTGSGGFVVLPDDDLYDRLRLRRWLGIERASDRITGDYDVAEWG
YRFILNEIGGAIGLSNLERVDELLRRHRENAAFYDKELAGIDGVEQTERADDREPAFWMY
PLKVRDRPAFMRRLLDAGIATSVVSRRNDAHSCVASARTTLPGLDRVADRVVHIPVGWWL
TEDDRSHVVETIKSGW
selected fasta
>NDP-sugar C-4 aminotransferase [CalS13]
ATGATCCCGCTGTCCAAGGTCGCCATGTCTCCGGACGTCAGCACCCGCGTCTCCGCCGTC
CTGAGCAGTGGCCGGCTGGAGCACGGGCCGACCGTCGCCGAGTACGAGGCGGCCGTGGGC
AGTCGTATCGGCAACCCCCGGGTGGTCTCGGTCAACTGCGGCACGGCCGGGCTCCACCTG
GCGCTGAGCCTCGCCGCGCGGCCGGGGGCCGGCGAGTCGGAGCACGACGGCCCGGGCGAG
GTGCTCACCACGCCGCTGACCTTCGAGGGCACGAACTGGCCGATCCTCGCCAACGGGCTG
CGCATCCGGTGGGTGGACGTCGACCCGGCCACCCTCAACATGGACCTCGACGACCTGGCC
GCGAAGATCTCGCCCGCCACCCGGGCCATCGTGGTGGTCCACTGGCTCGGCTACCCGGTG
GACCTCAACCGGCTGCGCGCCGTCGTGGACCGGGCCACGGCGGGATACGACCGCCGCCCG
CTGGTCGTGGAGGACTGCGCGCAGGCGTGGGGCGCCACCTACCGGGGCGCGCCGCTGGGC
ACGCACGGCAACGTCTGCGTGTACAGCACCGGCGCGATCAAGATCCTGACGACCGGCAGC
GGCGGCTTCGTCGTGCTGCCCGACGACGACCTGTACGACCGGCTCCGGCTGCGCCGCTGG
CTCGGCATCGAGCGGGCGTCGGACCGGATCACCGGCGACTACGACGTCGCCGAGTGGGGC
TACCGGTTCATCCTCAACGAGATCGGCGGGGCGATCGGCCTGTCCAACCTGGAACGCGTC
GACGAGCTGCTGCGCCGGCACCGGGAGAACGCCGCGTTCTACGACAAGGAACTGGCCGGC
ATCGACGGCGTCGAGCAGACCGAGCGGGCCGACGACCGGGAGCCCGCGTTCTGGATGTAC
CCGCTGAAGGTCCGCGACCGTCCCGCCTTCATGCGCCGGCTGCTCGACGCCGGCATCGCC
ACCAGCGTCGTGTCGCGCCGCAACGACGCGCACAGCTGCGTCGCGTCGGCCCGCACCACC
CTGCCCGGGCTGGACCGGGTGGCGGACCGCGTGGTCCACATCCCGGTGGGCTGGTGGCTC
ACCGAGGACGACCGCTCCCACGTCGTCGAAACGATCAAGTCCGGCTGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000653 DegT/DnrJ/EryC1/StrS aminotransferase (Family)
 [1-376]  2.19999900980707e-38 PIRSF000390
PIRSF000390   PLP_StrS
 [15-372]  3.19999999999996e-74 PF01041
PF01041   DegT_DnrJ_EryC1
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [2-259]  2.4e-62 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [261-374]  1.6e-17 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [1-376]  1.3000049540733e-78 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP No significant hit
TMHMM No significant hit