close all open/close all

CDS information : Calm_00600


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction71,392 / 72,522 / + [in whole cluster]
71,392 / 72,522 / + [in contig]
Location71392..72522 [in whole cluster]
71392..72522 [in contig]
TypeCDS
Length1,131 bp (376 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productglycosyltransferase
Product (GenBank)CalG3
Gene
Gene (GenBank)calG3
EC number
Keyword
  • 4-hydroxyamino-6-deoxy-alpha-D-glucose
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)
[18721755] Biochemical and structural insights of the early glycosylation steps in calicheamicin biosynthesis. (Chem Biol. , 2008)

close this sectionSequence

selected fasta
>glycosyltransferase [CalG3]
MLFVSSPGIGHLFPLIQLAWGFRTAGHDVLIAVAEHADRAAAAGLEVVDVAPDYSAVKVF
EQVAKDNPRFAETVATRPAIDLEEWGVQIAAVNRPLVDGTMALVDDYRPDLVVYEQGATV
GLLAADRAGVPAVQRNQSAWRTRGMHRSIASFLTDLMDKHQVSLPEPVATIESFPPSLLL
EAEPEGWFMRWVPYGGGAVLGDRLPPVPARPEVAITMGTIELQAFGIGAVEPIIAAAGEV
DADFVLALGDLDISPLGTLPRNVRAVGWTPLHTLLRTCTAVVHHGGGGTVMTAIDAGIPQ
LLAPDPRDQFQHTAREAVSRRGIGLVSTSDKVDADLLRRLIGDESLRTAAREVREEMVAL
PTPAETVRRIVERISG
selected fasta
>glycosyltransferase [CalG3]
GTGCTGTTCGTCTCCTCCCCCGGTATCGGCCACCTCTTCCCGCTGATCCAGCTCGCCTGG
GGCTTCCGCACGGCCGGCCACGACGTGCTGATCGCGGTCGCCGAGCACGCCGACCGGGCC
GCCGCCGCGGGCCTGGAGGTCGTCGACGTGGCGCCCGACTACAGCGCGGTCAAGGTCTTC
GAGCAGGTGGCCAAGGACAACCCGCGCTTCGCCGAGACCGTCGCCACGCGTCCCGCGATC
GATCTGGAGGAGTGGGGCGTGCAGATCGCGGCGGTGAACCGCCCGCTGGTCGACGGGACC
ATGGCGCTGGTCGACGACTACCGTCCCGACCTGGTGGTCTACGAGCAGGGCGCCACCGTC
GGCCTGCTGGCCGCCGACCGCGCCGGGGTGCCGGCAGTGCAGCGCAACCAGAGCGCCTGG
CGGACCCGGGGCATGCACCGCTCGATCGCGTCCTTCCTGACCGACCTGATGGACAAGCAC
CAGGTCAGCCTGCCCGAGCCGGTGGCGACGATCGAGTCGTTCCCGCCGAGCCTGCTGCTG
GAGGCGGAGCCCGAGGGCTGGTTCATGCGCTGGGTGCCGTACGGCGGCGGCGCCGTCCTC
GGCGACCGGCTGCCGCCGGTGCCCGCCCGGCCCGAGGTGGCGATCACCATGGGCACCATC
GAGCTCCAGGCGTTCGGCATCGGCGCCGTGGAGCCCATCATCGCCGCCGCCGGCGAGGTG
GACGCCGACTTCGTGCTCGCCCTCGGCGACCTCGACATCAGCCCGCTGGGCACGTTGCCG
CGCAACGTCCGGGCGGTCGGCTGGACGCCGCTGCACACCCTGCTGCGTACCTGCACCGCG
GTGGTGCACCACGGCGGGGGCGGCACGGTGATGACCGCCATCGACGCCGGCATCCCGCAG
CTGCTCGCCCCGGACCCGCGCGACCAGTTCCAGCACACCGCCCGGGAGGCCGTCAGCCGG
CGCGGCATCGGCCTGGTCAGCACGTCGGACAAGGTCGACGCGGACCTGCTGCGCCGGCTG
ATCGGGGACGAGTCGCTGCGCACCGCGGCCCGGGAGGTACGCGAGGAGATGGTCGCGCTG
CCCACGCCGGCGGAGACGGTGCGGCGCATCGTCGAGCGCATCTCGGGTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [3-132]  5.5e-08 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [171-264]  5.69999999999998e-22 PF06722
PF06722   DUF1205
SignalP No significant hit
TMHMM No significant hit