close all open/close all

CDS information : Calm_00610


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction72,606 / 73,799 / + [in whole cluster]
72,606 / 73,799 / + [in contig]
Location72606..73799 [in whole cluster]
72606..73799 [in contig]
TypeCDS
Length1,194 bp (397 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productcytochrome P450
Product (GenBank)CalO2
Gene
Gene (GenBank)calO2
EC number
Keyword
  • orsellinic acid moiety
  • C-3 hydroxylate
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)
[19055330] Characterization of CalE10, the N-oxidase involved in calicheamicin hydroxyaminosugar formation. (J Am Chem Soc. , 2008)
[18561189] Structural characterization of CalO2: a putative orsellinic acid P450 oxidase in the calicheamicin biosynthetic pathway. (Proteins. , 2009)
Related Reference
ACC
P53554
PmId
[11368323] Expression, purification, and characterization of BioI: a carbon-carbon bond cleaving cytochrome P450 involved in biotin biosynthesis in Bacillus subtilis. (Arch Biochem Biophys. , 2000)

close this sectionSequence

selected fasta
>cytochrome P450 [CalO2]
MTAFDPTDADVRRDPYPSYHWLLRHDPVHRGAHRVWYVSRFADVRAVLGDERFARTGIRR
FWTDLVGPGLLAEIVGDIILFQDEPDHGRLRGVVGPAFSPSALRRLEPVIAGTVDDLLRP
ALARGAMDVVDELAYPLALRAVLGLLGLPAADWGAVGRWSRDVGRTLDRGASAEDMRRGH
AAIAEFADYVERALARRRREGGEDLLALMLDAHDRGLMSRNEIVSTVVTFIFTGHETVAS
QVGNAVLSLLAHPDQLDLLRRRPDLLAQAVEECLRYDPSVQSNTRQLDVDVELRGRRLRR
DDVVVVLAGAANRDPRRYDRPDDFDIERDPVPSMSFGAGMRYCLGSYLARTQLRAAVAAL
ARLPGLRLGCASDALAYQPRTMFRGLASLPIAFTPGG
selected fasta
>cytochrome P450 [CalO2]
GTGACCGCGTTCGATCCCACCGACGCCGACGTGCGGCGTGACCCCTACCCGTCCTACCAC
TGGCTGCTGCGGCACGACCCGGTGCACCGTGGCGCCCACCGGGTCTGGTACGTCTCCCGC
TTCGCGGACGTGCGCGCGGTGCTCGGCGACGAGCGCTTCGCCCGGACCGGCATCCGCCGG
TTCTGGACCGACCTCGTCGGGCCCGGGCTGCTCGCCGAGATCGTCGGCGACATCATCCTG
TTCCAGGACGAGCCCGACCACGGCCGGCTGCGCGGGGTGGTCGGCCCGGCGTTCTCGCCG
TCCGCGCTGCGCCGGCTGGAACCGGTGATCGCCGGCACCGTGGACGACCTGCTGCGGCCC
GCCCTGGCCCGGGGCGCGATGGACGTGGTCGACGAGCTGGCGTACCCGCTGGCGCTGCGC
GCGGTCCTCGGCCTGCTCGGCCTGCCCGCCGCCGACTGGGGGGCGGTCGGGCGCTGGTCG
CGCGACGTGGGACGGACCCTGGACCGGGGCGCCAGCGCCGAGGACATGCGCCGCGGCCAC
GCGGCGATCGCCGAGTTCGCCGACTACGTGGAGCGGGCCCTCGCGAGGCGGCGGCGTGAG
GGCGGCGAGGACCTGCTGGCGTTGATGCTCGACGCCCACGACCGCGGCCTGATGAGTCGC
AACGAGATCGTCAGCACGGTGGTCACGTTCATCTTCACCGGCCACGAGACGGTGGCCAGC
CAGGTGGGCAACGCCGTGCTGAGCCTGCTGGCGCACCCGGACCAGCTCGACCTGCTCCGG
CGCCGGCCGGACCTGCTGGCCCAGGCCGTCGAGGAGTGCCTGCGGTACGACCCGTCGGTG
CAGTCCAACACCCGGCAGCTCGACGTCGACGTGGAGCTGCGCGGTCGGCGGCTGCGCCGC
GACGACGTCGTGGTCGTCCTGGCCGGCGCGGCGAACCGGGACCCGCGGCGGTACGACCGG
CCCGACGATTTCGACATCGAGCGGGATCCGGTCCCGTCGATGTCCTTCGGCGCGGGGATG
CGCTACTGCCTCGGGTCCTACCTCGCCCGTACGCAGCTGCGCGCCGCGGTGGCCGCCCTG
GCCCGACTGCCGGGCCTGCGGCTGGGCTGCGCGTCGGACGCCCTGGCCTATCAGCCGCGC
ACCATGTTCCGGGGCCTGGCCAGCCTGCCGATCGCGTTCACGCCGGGCGGTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [4-395]  2.30000000000004e-99 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [233-250]  8.59999720482718e-06 PR00385 [268-279]  8.59999720482718e-06 PR00385 [334-343]  8.59999720482718e-06 PR00385 [343-354]  8.59999720482718e-06 PR00385
PR00385   P450
 [15-395]  3.49999466863949e-86 SSF48264
SSF48264   Cytochrome_P450
 [177-359]  2.4e-22 PF00067
PF00067   p450
IPR002397 Cytochrome P450, B-class (Family)
 [82-93]  1.40000506907309e-38 PR00359 [128-144]  1.40000506907309e-38 PR00359 [145-160]  1.40000506907309e-38 PR00359 [188-210]  1.40000506907309e-38 PR00359 [268-279]  1.40000506907309e-38 PR00359 [285-312]  1.40000506907309e-38 PR00359 [313-328]  1.40000506907309e-38 PR00359 [334-343]  1.40000506907309e-38 PR00359 [343-354]  1.40000506907309e-38 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [336-345]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit