close all open/close all

CDS information : Calm_00620


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction73,840 / 75,102 / + [in whole cluster]
73,840 / 75,102 / + [in contig]
Location73840..75102 [in whole cluster]
73840..75102 [in contig]
TypeCDS
Length1,263 bp (420 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative halogenase
Product (GenBank)CalO3
Gene
Gene (GenBank)calO3
EC number
Keyword
  • orsellinic acid moiety
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)
[18561189] Structural characterization of CalO2: a putative orsellinic acid P450 oxidase in the calicheamicin biosynthetic pathway. (Proteins. , 2009)
Related Reference
ACC
Q8GMI1
NITE
C1027_00090
PmId
[16104723] Biosynthesis of the beta-amino acid moiety of the enediyne antitumor antibiotic C-1027 featuring beta-amino acyl-S-carrier protein intermediates. (J Am Chem Soc. , 2005)
[17887753] Regiospecific chlorination of (S)-beta-tyrosyl-S-carrier protein catalyzed by SgcC3 in the biosynthesis of the enediyne antitumor antibiotic C-1027. (J Am Chem Soc. , 2007)

close this sectionSequence

selected fasta
>putative halogenase [CalO3]
MSHPEPEYDVIVVGGGPAGSSTAGLLAQEGHRVLLLEREKFPRYHIGESLISGVTLTLDA
LGVRERMAELRFQIKHGGSLLWGADQTAPWSFRFREIRDARFDYSWQVRRAEFDAMLLDR
ARELGVVVVEGATVRGPLTDGERVAGVSYQFRGEADPIDARAAIVVDASGQQRWLGRHFG
LVSWHDDLRNMAAWSYYAGALRYPGDHEGDLLVESCAQGWLWYAPLSPTLTGIGYVTPSD
RFAETGLPPDQLLEKQIAESNEVSWLTAGARRVDVYRTARDWSYACSQFSGPGWVLVGDA
AAFIDPLLSSGVTLAMRGALSLSRAVHEALAAPEKERHLMQVYEDRYRDFLAALLDLIRF
FYDGAHGRDELHLRAQAIVDPDRLMPPKISFVSLLSGLARGDETLDRSPRTAIDRPSDAI
selected fasta
>putative halogenase [CalO3]
ATGAGCCACCCCGAACCCGAGTACGACGTGATCGTCGTGGGCGGCGGCCCGGCCGGATCG
AGCACGGCCGGTCTGCTCGCCCAGGAGGGCCACCGGGTCCTGCTGCTGGAGCGCGAGAAG
TTCCCCCGCTACCACATCGGCGAGTCCCTGATCAGCGGCGTCACCCTCACCCTGGACGCG
CTCGGCGTACGCGAGCGGATGGCGGAGCTGCGCTTCCAGATCAAACACGGCGGCAGCCTG
CTGTGGGGGGCCGATCAGACCGCCCCGTGGTCGTTCCGGTTCCGGGAGATCCGCGACGCC
CGGTTCGACTACTCGTGGCAGGTCCGGCGTGCCGAATTCGACGCGATGCTGCTGGACCGG
GCGCGGGAACTGGGCGTGGTGGTGGTCGAGGGAGCCACCGTCCGGGGGCCGCTGACCGAC
GGCGAGCGGGTCGCGGGCGTCAGCTACCAGTTCCGGGGTGAGGCCGACCCGATCGACGCC
CGCGCCGCGATCGTGGTCGACGCGTCGGGGCAGCAGCGCTGGCTCGGCCGGCACTTCGGG
TTGGTCTCCTGGCACGACGACCTGCGCAACATGGCGGCGTGGAGCTACTACGCCGGGGCG
CTGCGCTACCCCGGCGATCACGAGGGCGACCTGCTCGTCGAGAGCTGCGCCCAGGGTTGG
CTCTGGTACGCGCCGCTGAGCCCCACCCTGACCGGGATCGGGTACGTCACCCCGTCGGAC
CGGTTCGCCGAGACCGGCCTTCCCCCGGATCAGTTGCTGGAGAAACAGATCGCGGAGTCG
AACGAGGTCTCCTGGCTCACCGCCGGCGCGCGGCGGGTCGACGTCTACCGCACCGCGCGG
GACTGGTCGTACGCGTGCAGCCAGTTCTCCGGGCCGGGCTGGGTGCTGGTCGGTGACGCC
GCCGCCTTCATCGACCCCCTGCTGTCCTCCGGCGTGACGCTGGCGATGCGCGGCGCGCTC
AGCCTGTCCCGGGCGGTGCACGAGGCACTGGCCGCGCCGGAGAAGGAGCGCCATCTCATG
CAGGTGTACGAGGACCGCTACCGGGACTTCCTCGCCGCCCTGCTGGATCTGATCCGGTTC
TTCTACGACGGCGCGCACGGCCGCGACGAGTTGCACCTGCGCGCCCAGGCCATCGTGGAC
CCGGACCGGCTGATGCCTCCGAAGATCTCGTTCGTCTCCCTGCTGTCGGGGCTGGCGCGG
GGCGACGAGACGCTCGACCGCAGCCCTCGGACGGCCATTGACCGACCGTCAGACGCTATA
TAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [9-31]  3.0999994589937e-08 PR00420 [291-306]  3.0999994589937e-08 PR00420 [306-322]  3.0999994589937e-08 PR00420
PR00420   RNGMNOXGNASE
IPR006905 Tryptophan halogenase (Family)
 [9-96]  1.7e-13 PF04820 [100-369]  6.90000000000001e-22 PF04820
PF04820   Trp_halogenase
SignalP No significant hit
TMHMM No significant hit