close all open/close all

CDS information : Calm_00640


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction76,231 / 80,046 / + [in whole cluster]
76,231 / 80,046 / + [in contig]
Location76231..80046 [in whole cluster]
76231..80046 [in contig]
TypeCDS
Length3,816 bp (1,271 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
putative orsellinic acid synthase
Product (GenBank)CalO5
Gene
Gene (GenBank)calO5
EC number
Keyword
  • iterative
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)
[18561189] Structural characterization of CalO2: a putative orsellinic acid P450 oxidase in the calicheamicin biosynthetic pathway. (Proteins. , 2009)
Related Reference
ACC
O05170
NITE
Avil_00210
PmId
[9335272] Cloning of an avilamycin biosynthetic gene cluster from Streptomyces viridochromogenes Tu57. (J Bacteriol. , 1997)
ACC
P87162
PmId
[20304931] Hidden function of catalytic domain in 6-methylsalicylic acid synthase for product release. (J Biol Chem. , 2010)

close this sectionPKS/NRPS Module

B1 acetyl-CoA
malonyl-CoA
KS12..382
AT542..857
TH865..1006
ACP1180..1253

close this sectionSequence

selected fasta
>polyketide synthase [CalO5]
MTRDDPADNPYQVAVIGIGCRLPSDVDTPDALWELLLKGGQTAGEIPAQRWRAYRERGPE
YEAVLRDTVTAGSYLRDVAGFDPEFFGLSPREAAEMDPQQRILLEVGWEALEHAGLPPTR
LAGTDTGVFVGVSTTDYGDRLLEDLPTVEAYTGIGAATCALANRISYALDLRGPSVAVDT
ACSASLVAVHLACQSLLLRESTVALAGGVNLVLTPGQNASLQAAGTLSPDGVSKSFDRDA
DGYGRGEGCGVLVLKRLDEAERDGDRVLAVIRGSAVNQDGHTDGIMAPSGPAQQHVVRRA
CDRAGVAPASVDYVEAHGTGTQLGDPVEATALAAVYGAGRPDDRPCLIGSIKSNVGHLEG
AAGVAGLMKAILALHRGQIPGTPLRGQAIPAVGDGTGLRLVTGTLPWPERDGPRRAAVSG
FGYGGTIAHVVLEEAPPVPADGDAPAADEAARPLFPLSARSDAALRQQAARLADRLDGDD
RPDLVDVGHTLARRRAHLTHRAVVTGQDRDEVVAALRRLAAGQPDPDTVSAVTPAGRSAR
PVWVFSGHGSHWAGMGRDLLAHEPAFAAAIDEIEPVVAEEAGFSLRQALADPELAGVDRI
QTLTFAMHVGLAAVWRAYGVRPAAVIGHSVGEVAAAVTAGILTPTDGARLICRRSALLRR
AAGRGAMAMVTLPFADVAERLAGRADLVAAIASAPASTVVSGDIAAVDAVIEQWPADRIA
VRRVQSDVAFHSPHMDALADELRAAAADLPTSAGTVPMYSTVLDDPRAAAPCDGAYWAAN
LRRPVRLVDAVGAALADGHRTFVEISAHPVVAHSVRETLDHAGIEDGYVGTTLRRHVPGH
RTALAAVAEAHCHGVEVDWAALRPDGRLTDLPRYAWRHQELWREPTPPVAAGGHDIGSHT
LLGTATTVAGSDLRLWHTVLSDASRPYPGSHTVQGAELVPAAVLAATFLAAGARDGAPVA
LHDLSMRVPLATAGRQEIQVVDDGGKLLLASRPAGADTAPWLTHATARVTPDDAAPSARA
ADPRGPGGVVADPGLVRDRLARVGVPETGFPWRVDRLTTGNGGLRARVRFPEPAEDWAAV
IDAAVSIAPAAFPGEPRLRLVDAIERIWTTGVVPAVALVDVVRDGGREDTVDVTVSGADG
TLAARLTGLHYPVVPDAPAADTDGPAPTRQSLADLDPDELRERLIEEVRAAVAAEMKLAA
EALDPRLPLVQQGMDSVMTVIVRRRLEKTYRQVLPASLFWQQPTVTAIAVHLAELIAAPS
PDGAVADAVAR
selected fasta
>polyketide synthase [CalO5]
ATGACCCGGGACGATCCCGCCGACAACCCGTACCAGGTGGCCGTCATCGGCATCGGTTGC
CGGCTGCCCAGCGACGTCGACACCCCGGACGCCCTCTGGGAGCTGCTACTCAAGGGCGGC
CAGACCGCCGGCGAGATCCCGGCGCAGCGCTGGCGCGCCTACCGGGAGCGCGGCCCCGAG
TACGAGGCGGTCCTGCGCGACACCGTCACCGCCGGCAGCTACCTGCGTGACGTCGCGGGC
TTCGACCCCGAGTTCTTCGGCCTGTCGCCCCGGGAGGCGGCCGAGATGGACCCGCAGCAG
CGGATCCTGCTCGAGGTCGGCTGGGAGGCCCTGGAGCACGCCGGCCTGCCACCCACCCGG
CTGGCCGGCACCGACACGGGCGTCTTCGTCGGGGTCAGCACCACCGACTACGGCGACCGG
CTGCTGGAGGACCTGCCGACCGTCGAGGCGTACACCGGGATCGGCGCGGCCACCTGCGCC
CTGGCCAACCGCATCTCCTACGCGCTGGACCTGCGCGGCCCGAGCGTCGCCGTCGACACG
GCCTGCTCGGCGTCGCTGGTCGCGGTGCACCTGGCCTGCCAGAGCCTGCTGCTGCGGGAG
AGCACGGTGGCCCTGGCCGGCGGCGTGAACCTGGTGCTCACCCCGGGGCAGAACGCCTCC
CTCCAGGCCGCCGGCACGCTCTCCCCCGACGGCGTGAGCAAGTCGTTCGACCGCGACGCC
GACGGGTACGGCCGCGGCGAGGGATGCGGCGTGCTGGTGCTCAAGCGGCTCGACGAGGCC
GAACGGGACGGCGACCGGGTCCTGGCGGTGATCCGGGGCAGCGCGGTCAACCAGGACGGC
CACACCGACGGCATCATGGCCCCGTCCGGCCCCGCGCAGCAGCACGTCGTCCGCCGCGCC
TGCGACCGGGCGGGCGTCGCCCCGGCCAGCGTGGACTACGTGGAGGCGCACGGCACCGGC
ACCCAGCTCGGCGATCCCGTCGAGGCGACCGCCCTGGCCGCGGTCTACGGCGCCGGCCGC
CCCGACGACCGGCCCTGCCTCATCGGCTCGATCAAGTCCAACGTCGGGCACCTGGAGGGC
GCCGCCGGGGTCGCGGGGCTGATGAAGGCCATCCTCGCGCTGCACCGCGGCCAGATCCCG
GGCACCCCGCTGCGCGGCCAGGCGATCCCCGCCGTCGGCGACGGCACCGGGCTGCGCCTG
GTGACCGGCACGCTGCCCTGGCCCGAGCGGGACGGTCCGCGCCGCGCCGCGGTCTCCGGG
TTCGGCTACGGCGGCACCATCGCCCACGTCGTCCTGGAGGAGGCGCCGCCCGTTCCCGCC
GACGGCGACGCGCCGGCTGCCGACGAGGCCGCCCGGCCGCTGTTCCCGCTGTCGGCCCGA
TCGGACGCCGCCCTGCGCCAGCAGGCCGCCCGACTCGCCGACCGGCTCGACGGGGACGAC
CGGCCGGACCTGGTCGACGTCGGCCACACGCTCGCGCGCCGCCGGGCCCACCTGACCCAC
CGCGCGGTGGTCACCGGGCAGGACCGCGACGAGGTCGTCGCCGCCCTGCGCCGGCTCGCC
GCCGGCCAACCCGACCCCGACACGGTCTCGGCAGTGACGCCGGCCGGCCGGTCCGCCCGG
CCCGTCTGGGTCTTCTCCGGGCACGGCTCGCACTGGGCCGGCATGGGCCGCGACCTGCTG
GCCCACGAACCGGCCTTCGCCGCCGCGATCGACGAGATCGAACCGGTCGTCGCCGAGGAG
GCCGGCTTCTCGCTGCGGCAGGCCCTCGCCGACCCCGAGCTGGCCGGGGTGGACCGCATC
CAGACCCTGACCTTCGCCATGCACGTCGGCCTGGCCGCGGTCTGGCGGGCGTACGGTGTC
CGCCCGGCCGCCGTCATCGGGCACTCGGTCGGCGAGGTCGCCGCCGCCGTGACCGCGGGC
ATCCTCACCCCGACCGACGGGGCCCGGCTGATCTGCCGCCGGTCCGCCCTGCTGCGGCGG
GCCGCCGGCCGGGGCGCGATGGCCATGGTCACCCTGCCGTTCGCCGACGTCGCCGAGCGG
CTCGCCGGCCGCGCCGACCTCGTCGCGGCGATCGCCTCCGCCCCCGCGTCCACCGTGGTC
TCCGGCGACATCGCCGCCGTGGACGCCGTGATCGAGCAGTGGCCGGCGGACCGGATCGCG
GTGCGCCGGGTGCAGTCCGACGTGGCGTTCCACAGCCCGCACATGGACGCCCTCGCCGAC
GAGCTGCGGGCCGCCGCGGCCGACCTGCCCACCTCGGCGGGCACCGTGCCGATGTACTCG
ACGGTGCTCGACGACCCGCGCGCCGCGGCCCCCTGCGACGGGGCGTACTGGGCGGCGAAC
CTGCGCCGACCGGTCCGCCTGGTCGACGCGGTCGGCGCCGCCCTGGCCGACGGGCACCGC
ACCTTCGTCGAGATCTCCGCCCACCCGGTGGTCGCCCACTCTGTGCGGGAGACCCTCGAC
CACGCCGGCATCGAGGACGGGTACGTCGGGACCACGCTGCGCCGTCACGTTCCCGGGCAC
CGCACGGCCCTCGCCGCGGTGGCGGAGGCGCACTGCCACGGCGTCGAGGTCGACTGGGCC
GCGCTGCGGCCCGACGGCAGGCTCACCGACCTGCCCCGGTACGCCTGGCGGCACCAGGAG
CTGTGGCGGGAGCCCACTCCCCCGGTGGCCGCCGGCGGGCACGACATCGGCTCGCACACC
CTGCTCGGCACGGCGACCACCGTCGCCGGCAGCGACCTGCGGCTGTGGCACACGGTGCTC
AGCGACGCCAGCCGTCCGTACCCGGGCAGCCACACCGTGCAGGGCGCGGAGCTCGTGCCG
GCCGCGGTGCTCGCCGCCACCTTCCTCGCCGCCGGGGCCCGCGACGGCGCGCCGGTGGCC
CTGCACGACCTGTCGATGCGGGTGCCGCTGGCCACGGCCGGGCGCCAGGAGATCCAGGTG
GTGGACGACGGCGGGAAGCTGCTGCTCGCCTCCCGCCCGGCCGGCGCGGACACCGCGCCG
TGGCTGACCCACGCCACCGCGCGCGTGACGCCGGACGACGCCGCCCCGTCGGCGCGGGCC
GCCGACCCCCGGGGGCCGGGCGGGGTGGTCGCCGACCCGGGGCTCGTCCGGGACCGGCTG
GCCCGGGTCGGGGTGCCCGAGACGGGCTTCCCATGGCGGGTCGACCGCCTCACCACCGGC
AACGGCGGGCTGCGGGCCCGGGTCCGCTTCCCCGAGCCGGCCGAGGACTGGGCGGCCGTC
ATCGACGCGGCGGTGTCCATCGCGCCGGCCGCGTTCCCCGGCGAGCCCCGGCTGCGCCTG
GTCGACGCGATCGAGCGGATCTGGACGACCGGCGTGGTGCCGGCCGTCGCCCTCGTCGAC
GTCGTCCGGGACGGCGGGCGGGAGGACACCGTCGACGTGACGGTCTCCGGGGCGGACGGC
ACTCTCGCCGCCCGGCTCACGGGCCTGCACTACCCGGTGGTCCCCGACGCCCCGGCCGCC
GACACCGACGGGCCCGCCCCGACCCGGCAGTCCCTGGCCGACCTCGACCCGGACGAACTG
CGCGAGCGCCTGATCGAGGAGGTCCGCGCGGCGGTCGCCGCCGAGATGAAGCTGGCCGCC
GAGGCGCTCGACCCGCGCCTGCCGCTGGTGCAGCAGGGCATGGACTCGGTCATGACCGTC
ATCGTGCGCCGGCGGCTGGAGAAGACCTACCGCCAGGTGCTGCCCGCCTCGTTGTTCTGG
CAGCAGCCCACCGTCACGGCGATCGCGGTGCACCTGGCCGAGCTGATCGCCGCCCCCTCG
CCGGACGGGGCGGTCGCCGACGCCGTGGCCCGCTGA
[1] KS12..382
[1] AT542..857
[1] acetyl-CoA malonyl-CoA728..732
[1] TH865..1006
[1] ACP1180..1253
[1] KS34..1146
[1] AT1624..2571
[1] acetyl-CoA malonyl-CoA2182..2196
[1] TH2593..3018
[1] ACP3538..3759

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [531-661]  1.40000000000001e-61 G3DSA:3.40.366.10 [728-845]  1.40000000000001e-61 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR009081 Acyl carrier protein-like (Domain)
 [1175-1260]  3.59999643435987e-15 SSF47336
SSF47336   ACP_like
 [1182-1256]  5.40000000000001e-13 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1180-1253]  PS50075
PS50075   ACP_DOMAIN
 [1187-1250]  5.2e-07 PF00550
PF00550   PP-binding
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [12-260]  6.20000000000009e-85 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [268-382]  6.40000000000004e-45 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [542-857]  3.79999999999991e-92 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [540-837]  2.69998997787809e-57 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [663-727]  3.1999989904635e-11 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [12-271]  1.60000000000002e-92 G3DSA:3.40.47.10 [272-437]  2.19999999999997e-59 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [3-437]  4.30000170645869e-101 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [173-189]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [544-836]  4.50001022902825e-88 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1185-1256]  4.60000044330862e-17 SM00823
SM00823   PKS_PP
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [13-437]  SM00825
SM00825   PKS_KS
SignalP No significant hit
TMHMM No significant hit