close all open/close all

CDS information : Calm_00650


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction80,077 / 81,147 / + [in whole cluster]
80,077 / 81,147 / + [in contig]
Location80077..81147 [in whole cluster]
80077..81147 [in contig]
TypeCDS
Length1,071 bp (356 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
ProductC-2 O-methyltransferase
Product (GenBank)CalO6
Gene
Gene (GenBank)calO6
EC number2.1.1.-
Keyword
  • orsellinic acid moiety
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)
[21358050] Structural characterization of CalO1: a putative orsellinic acid methyltransferase in the calicheamicin-biosynthetic pathway. (Acta Crystallogr D Biol Crystallogr. , 2011)
[24978950] Characterization of the calicheamicin orsellinate C2-O-methyltransferase CalO6. (Chembiochem. , 2014)

close this sectionSequence

selected fasta
>C-2 O-methyltransferase [CalO6]
MELTTTAARPGLRHRMQQLIYGFFTAQTLHVAVRLRIPDLLADGARDVGDLASATGADAP
SLRRLLRALVFLEVLDEPAPGTFALTEQGEVLRADVTGSMRELVLLLSGPESWAAWGQLE
HSVRTGEVAWEHVHGRSCFDHLMADPQRQAAFNAAMAEGSRAFVPTLLSAYDFGDLRTVV
DVGGGSGALLAGVLAAHPHLRGTVFDTPDGVADAARTVAEQGVADRCGVETGDFFVSVPP
GADAYVLKSVLHDWDDEQCVEVLRTVRRAVRPDSRVILVESLMPTTVTTAPSVAQVVMND
LNMMVCHGGRERTVAEFRELLRVAGFRLESVTPCPAPSVVGILEAAPAPATGPDGS
selected fasta
>C-2 O-methyltransferase [CalO6]
ATGGAACTCACCACGACCGCCGCCCGGCCCGGGCTGCGGCACCGGATGCAACAGCTGATC
TACGGGTTCTTCACGGCGCAGACGCTGCACGTGGCGGTCCGGCTGCGGATACCGGACCTG
CTCGCCGACGGCGCGCGCGACGTCGGCGACCTCGCGTCGGCCACCGGCGCGGACGCCCCG
TCGCTGCGCCGGCTGCTGCGGGCGCTGGTCTTCCTGGAGGTGCTCGACGAGCCCGCGCCA
GGCACCTTCGCCCTCACCGAACAGGGCGAGGTGCTGCGGGCGGACGTGACCGGGTCGATG
CGGGAGCTGGTGCTGCTGCTGTCCGGGCCGGAGAGCTGGGCCGCGTGGGGGCAGCTCGAA
CACAGCGTGCGCACCGGCGAGGTGGCGTGGGAGCACGTGCACGGCCGGAGCTGCTTCGAC
CACCTGATGGCGGACCCGCAGCGGCAGGCGGCGTTCAACGCGGCCATGGCCGAGGGCTCG
CGGGCCTTCGTGCCCACGCTGCTGTCGGCGTACGACTTCGGCGACCTGCGCACCGTGGTG
GACGTGGGCGGCGGCAGCGGCGCCCTGCTCGCCGGGGTCCTCGCGGCGCACCCGCACCTG
CGCGGCACGGTCTTCGACACCCCGGACGGCGTGGCCGACGCGGCGCGCACGGTCGCCGAG
CAGGGCGTCGCCGACCGGTGCGGGGTGGAGACCGGTGACTTCTTCGTCTCCGTGCCACCG
GGCGCGGACGCCTACGTGCTCAAGAGCGTGCTGCACGACTGGGACGACGAGCAGTGCGTC
GAGGTGCTGCGCACCGTCCGCCGGGCGGTCCGACCCGACAGCCGCGTGATCCTCGTCGAG
TCGCTGATGCCGACGACGGTCACCACGGCGCCGAGCGTCGCCCAGGTGGTCATGAACGAC
CTCAACATGATGGTCTGCCACGGCGGCCGGGAGCGCACCGTGGCGGAGTTCCGCGAGTTG
CTGCGGGTGGCGGGCTTCCGGCTGGAGTCCGTCACGCCCTGCCCGGCGCCGAGCGTCGTC
GGCATCCTGGAGGCGGCGCCCGCCCCGGCCACCGGGCCGGACGGGAGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001077 O-methyltransferase, family 2 (Domain)
 [82-321]  9.49999999999983e-69 PF00891
PF00891   Methyltransf_2
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [14-89]  3.90000000000001e-15 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016461 O-methyltransferase, caffeic acid-type (Family)
 [1-345]  5.59999989417026e-41 PIRSF005739
PIRSF005739   O-mtase
SignalP No significant hit
TMHMM No significant hit