close all open/close all

CDS information : Calm_00660


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction81,152 / 82,102 / + [in whole cluster]
81,152 / 82,102 / + [in contig]
Location81152..82102 [in whole cluster]
81152..82102 [in contig]
TypeCDS
Length951 bp (316 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)CalU17
Gene
Gene (GenBank)calU17
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)

close this sectionSequence

selected fasta
>hypothetical protein [CalU17]
MARIGDLDAARPAPEAVPGDMVRIPGGTFLQGSPERTLDWLDREGQAFPRDWFTDETPQI
PVTLPDYLIDRHQVTVAQFAAFVSRTGYVTSAERAGGSMVYGEQYWEIREGACWHRPAGY
GSGIRGRDDHPVVHISFADAEAYARWAGRRLPTESEWERAATGPSYRLWPWGDTWDSRNA
NTAEHTAGALGDLDAWRTWWGAIHAVQGPMPQTTPVGAFSPRGDSVDGCADMTGNVYEWT
STLAHLYSPATRCDPTIHLVMGRSRVIRGGSWMNFRYQVRCAERLYGDPTGWSNFALGFR
CARDVTAVPHVDDNGR
selected fasta
>hypothetical protein [CalU17]
ATGGCGCGCATCGGCGACCTCGACGCCGCCCGGCCCGCGCCGGAGGCGGTCCCCGGGGAC
ATGGTCCGCATCCCGGGCGGGACGTTCCTGCAGGGCTCGCCCGAGCGGACGCTGGACTGG
CTGGACCGCGAGGGGCAGGCGTTCCCCCGCGACTGGTTCACCGACGAGACGCCGCAGATT
CCGGTCACGCTGCCCGACTACCTCATCGACCGGCACCAGGTGACCGTCGCCCAGTTCGCC
GCCTTCGTCTCCCGCACCGGCTACGTCACGTCCGCCGAGCGGGCCGGGGGCAGCATGGTC
TACGGCGAGCAGTACTGGGAGATCCGCGAGGGGGCCTGCTGGCACCGCCCGGCCGGGTAC
GGCAGCGGCATCCGCGGCCGCGACGACCACCCCGTCGTGCACATCTCCTTCGCCGACGCC
GAGGCGTACGCGCGCTGGGCGGGCCGGCGGCTGCCCACCGAGTCGGAGTGGGAGCGGGCC
GCCACCGGCCCGTCGTACCGGCTCTGGCCCTGGGGGGACACCTGGGACAGCAGGAACGCC
AACACCGCCGAGCACACGGCCGGGGCGCTCGGCGACCTGGACGCCTGGCGGACCTGGTGG
GGGGCGATCCACGCCGTGCAGGGGCCGATGCCGCAGACCACGCCGGTCGGGGCGTTCTCG
CCGCGCGGCGACAGCGTCGACGGGTGCGCCGACATGACCGGCAACGTCTACGAGTGGACG
TCCACCCTGGCGCACCTCTACTCGCCCGCCACCCGGTGCGACCCGACGATCCACCTGGTC
ATGGGGCGTTCCCGCGTGATCCGGGGCGGCTCCTGGATGAACTTCCGCTACCAGGTCCGG
TGCGCGGAACGGCTGTACGGGGACCCCACCGGATGGTCCAACTTCGCTCTCGGCTTCCGC
TGTGCGCGTGACGTCACGGCGGTCCCCCACGTCGACGACAACGGGAGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005532 Formylglycine-generating sulphatase enzyme domain (Domain)
 [20-303]  1.9e-59 PF03781
PF03781   FGE-sulfatase
 [12-305]  2.09999999999996e-68 G3DSA:3.90.1580.10
G3DSA:3.90.1580.10   SO4-mod_fac-like
IPR016187 C-type lectin fold (Domain)
 [16-305]  2.19999900980707e-67 SSF56436
SSF56436   C-type_lectin_fold
SignalP No significant hit
TMHMM No significant hit