close all open/close all

CDS information : Calm_00670


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction82,105 / 82,371 / + [in whole cluster]
82,105 / 82,371 / + [in contig]
Location82105..82371 [in whole cluster]
82105..82371 [in contig]
TypeCDS
Length267 bp (88 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)CalU18
Gene
Gene (GenBank)calU18
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)

close this sectionSequence

selected fasta
>hypothetical protein [CalU18]
MVTVLLSAGWAHRGQKSFECREGTVRDVIREFVETYPVYRRRLLDDTGEPLTYYNVYLDG
DLVEKADRSRVTARADSTVAIVPPLAGG
selected fasta
>hypothetical protein [CalU18]
ATGGTCACGGTGCTGCTGTCGGCCGGCTGGGCCCACCGGGGGCAGAAGAGTTTCGAGTGC
CGTGAGGGCACCGTGCGGGACGTCATCAGGGAGTTCGTCGAGACGTACCCCGTCTACCGC
CGCCGGCTGCTCGACGACACGGGCGAGCCGCTGACCTACTACAACGTCTACCTCGACGGG
GACCTCGTCGAGAAGGCGGACCGGTCCCGGGTGACCGCCCGAGCCGACAGCACGGTCGCC
ATCGTCCCGCCGCTGGCCGGGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003749 ThiamineS/Molybdopterin converting factor subunit 1 (Family)
 [15-88]  4.40000000000001e-06 PF02597
PF02597   ThiS
IPR012675 Beta-grasp domain (Domain)
 [13-86]  6e-13 G3DSA:3.10.20.30
G3DSA:3.10.20.30   Ferredoxin_fold
IPR016155 Molybdopterin synthase/thiamin biosynthesis sulphur carrier, beta-grasp (Domain)
 [1-88]  8.19999506482837e-14 SSF54285
SSF54285   Mo_synth/thiamin_syn_S_b-grasp
SignalP No significant hit
TMHMM No significant hit