close all open/close all

CDS information : Calm_00680


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction82,456 / 83,886 / + [in whole cluster]
82,456 / 83,886 / + [in contig]
Location82456..83886 [in whole cluster]
82456..83886 [in contig]
TypeCDS
Length1,431 bp (476 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-sugar 2,3-dehydratase
Product (GenBank)CalS14
Gene
Gene (GenBank)calS14
EC number
Keyword
  • aminodideoxypentose
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)
[19058170] Natural-product sugar biosynthesis and enzymatic glycodiversification. (Angew Chem Int Ed Engl. , 2008)
Related Reference
ACC
B3TMP2
PmId
[17985890] Elucidation of the kijanimicin gene cluster: insights into the biosynthesis of spirotetronate antibiotics and nitrosugars. (J Am Chem Soc. , 2007)
ACC
Q9ALN6
NITE
Spino_00070
PmId
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)
ACC
Q0H2W5
PmId
[26289554] Characterization of Early Enzymes Involved in TDP-Aminodideoxypentose Biosynthesis en Route to Indolocarbazole AT2433. (Chembiochem. , 2015)

close this sectionSequence

selected fasta
>putative NDP-sugar 2,3-dehydratase [CalS14]
MLLPHTDARPGPGRADRDDLALRLARSARHRPRSAARLAAWLAQRQRANPFEVTAVPFAD
LTGWHFAPDSGDLVHESGRFFSVEGLHVRTDRGPVGEWWQPIIHQPDRAILGILAREIDG
VLHFLMQAKMEPGNVNGVQFSPTVQSTPSNYQRTHRGARSRYVEYFLEPGRGRVLVDVLQ
SEQGSWFRGKRNRNIIVEVADEVAPHEDFVWLTLGQIHDLLHRPNLVNMDARTVLSCLPG
HAVADGDGDAGTIGGAVAESSLADGAWQPLLGVRNWLTANKAGPTLATRQVPLREVRDWY
RADDEIRHRSGRFFRIVGRRVRASNREVSQWCQPLLAPCGTGLVAFVVRRIDGVLHVLAH
ADLRPGYRDTVELGPTVQCTPDNFTGPARDGRPAYLDLVLSDEVRVHYDVLQSEEGGRFH
HAVTRHMVVEVGPDFPTATPPDYTWLTLRQLTAVAAFSYQVNIEARSLLLCLRALR
selected fasta
>putative NDP-sugar 2,3-dehydratase [CalS14]
ATGCTCCTGCCGCACACCGACGCCCGACCCGGCCCCGGGCGGGCCGATCGTGACGACCTC
GCTCTCCGGCTGGCCCGGTCGGCCCGGCACCGCCCCCGCTCGGCCGCCCGGCTCGCGGCC
TGGCTCGCGCAGCGACAGCGGGCAAACCCGTTCGAGGTCACCGCGGTGCCGTTCGCCGAC
CTGACCGGCTGGCACTTCGCGCCGGACTCCGGCGACCTGGTGCACGAGAGCGGCCGGTTC
TTCAGCGTCGAGGGCCTGCACGTACGGACCGACCGCGGGCCGGTCGGCGAGTGGTGGCAG
CCGATCATCCACCAGCCCGACCGGGCGATCCTCGGCATCCTGGCCCGGGAGATCGACGGG
GTGCTGCACTTCCTGATGCAGGCCAAGATGGAGCCGGGAAACGTCAACGGCGTCCAGTTC
TCCCCCACCGTGCAGTCCACCCCGAGCAACTACCAGCGCACGCACCGCGGTGCCCGGTCC
CGCTACGTGGAGTACTTCCTGGAACCGGGGCGCGGCCGGGTCCTGGTGGACGTGCTCCAG
TCGGAGCAGGGCTCCTGGTTCCGGGGCAAGCGCAACCGGAACATCATCGTCGAGGTCGCC
GACGAGGTGGCACCGCACGAGGACTTCGTGTGGCTGACCCTCGGCCAGATCCACGATCTG
CTGCACCGGCCGAACCTGGTCAACATGGACGCCCGTACCGTCCTGTCCTGCCTGCCCGGC
CACGCGGTCGCCGACGGCGACGGGGACGCCGGGACGATCGGCGGCGCGGTGGCGGAGTCC
TCGCTGGCCGACGGCGCGTGGCAACCGCTGCTCGGCGTCCGCAACTGGCTGACCGCCAAC
AAGGCCGGCCCCACCCTGGCGACCCGGCAGGTCCCGCTGCGCGAGGTGCGCGACTGGTAC
CGCGCCGACGACGAGATCCGCCACCGCTCCGGCCGGTTCTTCCGCATCGTCGGCCGGCGG
GTGCGGGCCAGCAACCGCGAGGTGTCCCAGTGGTGCCAGCCGTTGCTGGCACCGTGCGGG
ACGGGTCTGGTGGCGTTCGTCGTCCGACGCATCGACGGCGTGCTGCACGTGCTCGCCCAC
GCCGACCTGCGGCCCGGCTACCGGGACACCGTCGAGCTGGGACCGACCGTGCAGTGCACC
CCGGACAACTTCACCGGCCCGGCCCGGGACGGCCGCCCGGCGTACCTCGACCTGGTGCTC
TCCGACGAGGTCCGCGTGCACTACGACGTGCTGCAGTCGGAGGAGGGCGGGCGGTTCCAC
CACGCGGTGACCCGGCACATGGTGGTGGAGGTGGGCCCGGACTTCCCCACCGCGACACCG
CCGGACTACACCTGGCTGACCCTGCGCCAGTTGACCGCCGTGGCGGCCTTCAGCTATCAG
GTCAACATCGAGGCGCGCAGCCTCCTGCTCTGCCTGCGGGCGCTGCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005212 NDP-hexose 2,3-dehydratase (Domain)
 [35-238]  3.10000000000005e-84 PF03559 [273-472]  1.9e-75 PF03559
PF03559   Hexose_dehydrat
SignalP No significant hit
TMHMM No significant hit