close all open/close all

CDS information : Calm_00690


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction84,045 / 85,229 / + [in whole cluster]
84,045 / 85,229 / + [in contig]
Location84045..85229 [in whole cluster]
84045..85229 [in contig]
TypeCDS
Length1,185 bp (394 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductNDP-aminosugar N-oxidase
Product (GenBank)CalE10
Gene
Gene (GenBank)calE10
EC number
Keyword
  • 4-hydroxyamino-6-deoxy-alpha-D-glucose
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)
[19055330] Characterization of CalE10, the N-oxidase involved in calicheamicin hydroxyaminosugar formation. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>NDP-aminosugar N-oxidase [CalE10]
MPRRCPFGPPAEYARLRTERPVARLPMLGGNTAWVVSRYADVKRVLSDPRMSADRRRAGF
PRFAPTTESQRQASFANFRPPLNWMDPPEHTAARRQIVDEFAARRVRQLRPLVERVVDEH
LDAMTAGRSSADLVPSFSYPVPSRVICEMLGVPYGEHAFFERRSTRMLSRGVPADERARC
AREIREFLDGVVTDKERHPGDDVLSRLLAAQRAAGEPDHEAVVSMAFVLLVAGHVTTSNM
ISLSVLALLTHPERLARLRAEPDRFPAAVEELLRYFTIVEAATARTATADVTVGGVTIRA
GEGVVALGQAANRDPAAFDRPDEFDPDRDARHHLAFGYGRHICPGQHLARLELDVALSRL
VRRLPGLRLTVDVDDLPLKEDGNIFGLHALPVAW
selected fasta
>NDP-aminosugar N-oxidase [CalE10]
CTGCCCCGCCGGTGCCCGTTCGGCCCGCCGGCCGAGTACGCCCGGCTGCGGACCGAGCGG
CCGGTCGCCCGGCTGCCCATGCTCGGCGGCAACACGGCCTGGGTGGTGTCCCGGTACGCC
GACGTCAAGCGGGTGCTCAGCGACCCGCGGATGAGCGCGGACCGGCGCCGGGCCGGTTTT
CCGCGGTTCGCGCCGACCACCGAGAGCCAGCGGCAGGCCTCGTTCGCGAACTTCCGCCCC
CCGCTGAACTGGATGGACCCGCCGGAGCACACCGCCGCCCGCCGCCAGATCGTCGACGAG
TTCGCCGCGCGGCGGGTACGACAGCTGCGGCCGCTGGTCGAGCGGGTGGTGGACGAGCAC
CTCGACGCCATGACGGCCGGGCGGTCGAGCGCCGACCTGGTGCCGTCGTTCAGCTATCCG
GTGCCGTCGCGGGTGATCTGCGAGATGCTCGGCGTGCCGTACGGCGAACACGCGTTCTTC
GAGCGCCGGTCCACCCGGATGCTGAGTCGCGGCGTGCCCGCGGACGAGCGGGCCCGGTGC
GCCCGCGAGATCCGCGAGTTCCTCGACGGCGTGGTGACCGACAAGGAGCGGCACCCCGGC
GACGACGTGCTCAGCCGGCTGCTCGCCGCGCAGCGCGCGGCCGGCGAGCCCGACCACGAG
GCCGTGGTGAGCATGGCCTTCGTGCTGCTGGTCGCCGGGCACGTCACGACGTCGAACATG
ATCTCGCTGAGCGTGCTGGCCCTGTTGACCCATCCGGAGCGGCTCGCCCGCCTGCGCGCC
GAGCCGGACCGGTTCCCCGCCGCCGTCGAGGAGCTGCTGCGGTACTTCACCATCGTCGAG
GCGGCGACCGCGCGGACCGCGACCGCCGACGTGACGGTCGGTGGGGTCACCATCCGGGCC
GGGGAGGGGGTGGTGGCGCTGGGCCAGGCCGCCAACCGGGACCCGGCGGCGTTCGACCGG
CCGGACGAGTTCGACCCGGACCGCGACGCCCGGCACCACCTCGCCTTCGGCTACGGACGA
CACATCTGCCCCGGCCAGCACCTGGCCCGGCTGGAACTGGACGTCGCGCTGAGCCGGCTG
GTCCGGCGGCTGCCCGGGCTGCGGTTGACCGTGGACGTGGACGACCTGCCGCTCAAGGAG
GACGGCAACATCTTCGGCCTGCACGCGCTGCCGGTCGCCTGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [7-394]  2.30000000000004e-111 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [232-249]  3.79999862644791e-08 PR00385 [267-278]  3.79999862644791e-08 PR00385 [334-343]  3.79999862644791e-08 PR00385 [343-354]  3.79999862644791e-08 PR00385
PR00385   P450
 [2-394]  4.99996518094122e-101 SSF48264
SSF48264   Cytochrome_P450
 [180-364]  4.9e-30 PF00067
PF00067   p450
IPR002397 Cytochrome P450, B-class (Family)
 [85-96]  1.40000506907309e-52 PR00359 [132-148]  1.40000506907309e-52 PR00359 [149-164]  1.40000506907309e-52 PR00359 [186-208]  1.40000506907309e-52 PR00359 [267-278]  1.40000506907309e-52 PR00359 [285-312]  1.40000506907309e-52 PR00359 [313-328]  1.40000506907309e-52 PR00359 [334-343]  1.40000506907309e-52 PR00359 [343-354]  1.40000506907309e-52 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [336-345]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit