close all open/close all

CDS information : Calm_00700


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction85,998 / 85,300 / - [in whole cluster]
85,998 / 85,300 / - [in contig]
Locationcomplement(85300..85998) [in whole cluster]
complement(85300..85998) [in contig]
TypeCDS
Length699 bp (232 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.4 resistance
Productcalicheamicin resistance protein
Product (GenBank)CalU19
Gene
Gene (GenBank)calU19
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)
[25079510] Structure-guided functional characterization of enediyne self-sacrifice resistance proteins, CalU16 and CalU19. (ACS Chem Biol. , 2014)

close this sectionSequence

selected fasta
>calicheamicin resistance protein [CalU19]
MHDAPALWGTNRTLGKSWLLKSSACGPDRLPWHHAPVGRSSGMNKTSDVVRDTERELRDH
PSGLNALVVRRSYDASPEELWDAITDPERLVRWFLPISGDLRVGGRFQLEGNASGEILRC
ERPSTIGLTWESGDGSSEVELRLTPSGDATVLELEHAPVPAEIIPNAAPGAWGIGAGWEM
GLVALDDYLAGTLPEGRAVDWIAKAGPEEMAAASESAQRISEAWTTVIAQRR
selected fasta
>calicheamicin resistance protein [CalU19]
GTGCACGACGCGCCAGCGTTGTGGGGCACAAATCGGACGTTAGGTAAGTCATGGCTGCTA
AAGTCCTCGGCGTGCGGGCCGGACCGGCTCCCGTGGCACCACGCACCTGTAGGAAGGTCA
AGTGGCATGAACAAGACGTCCGACGTCGTCAGGGACACCGAGCGCGAGCTGCGCGATCAC
CCCAGCGGATTGAACGCCCTGGTGGTCCGCCGCAGCTACGACGCCTCACCGGAGGAGCTG
TGGGACGCCATCACCGATCCCGAGCGCCTGGTGCGCTGGTTCCTGCCGATCTCCGGTGAC
CTGCGGGTGGGCGGGCGCTTCCAGCTGGAGGGCAACGCCAGCGGCGAGATCCTGCGGTGC
GAGCGGCCCAGCACGATCGGCCTGACCTGGGAGTCGGGCGACGGCAGCAGCGAGGTCGAG
CTGCGACTCACCCCGTCGGGCGACGCCACCGTTCTGGAGCTGGAGCACGCGCCGGTGCCG
GCCGAGATCATCCCCAACGCGGCGCCGGGGGCGTGGGGCATCGGGGCCGGCTGGGAGATG
GGCCTGGTCGCGCTCGACGACTACCTCGCCGGCACGCTTCCCGAGGGTCGGGCGGTCGAC
TGGATCGCCAAGGCGGGCCCCGAGGAGATGGCGGCCGCGTCCGAGTCGGCCCAGCGGATC
AGCGAGGCGTGGACGACGGTGATCGCCCAGCGTCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013538 Activator of Hsp90 ATPase homologue 1-like (Family)
 [74-189]  1.69999999999999e-20 PF08327
PF08327   AHSA1
IPR023393 START-like domain (Domain)
 [64-191]  4.70000000000003e-33 G3DSA:3.30.530.20
G3DSA:3.30.530.20   G3DSA:3.30.530.20
SignalP No significant hit
TMHMM No significant hit