close all open/close all

CDS information : Calm_00710


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction86,669 / 86,118 / - [in whole cluster]
86,669 / 86,118 / - [in contig]
Locationcomplement(86118..86669) [in whole cluster]
complement(86118..86669) [in contig]
TypeCDS
Length552 bp (183 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)CalU20
Gene
Gene (GenBank)calU20
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)

close this sectionSequence

selected fasta
>hypothetical protein [CalU20]
MSSTRRIYAGAALTVAALVAVLALAGRIDSQSTAASKVEVVSVDPADGAVLSGAPTAVRI
RVAGRPDLAGSHISVYDADRSLLNQGALTAAGRDGLTQAVRATGSGEVAVAYHVVTVDGR
DASGIARFTVGAPGGAPPPEPPAPAHAHGIDPVGAALLAVDGLALLAVLVLLARRSRTDR
DIA
selected fasta
>hypothetical protein [CalU20]
ATGTCGAGCACGAGACGGATCTACGCCGGCGCCGCCCTCACCGTGGCGGCGCTGGTGGCC
GTCCTCGCCCTCGCCGGCAGGATCGACTCGCAGTCCACGGCCGCGTCGAAGGTCGAGGTG
GTCTCGGTCGACCCGGCCGATGGCGCCGTCCTGTCGGGCGCGCCGACGGCGGTACGCATC
CGGGTGGCCGGCCGGCCGGACCTCGCCGGATCCCACATCTCCGTCTACGACGCGGACCGG
TCCCTGCTCAACCAGGGGGCGCTGACGGCCGCCGGCCGCGACGGCCTGACCCAGGCGGTG
CGGGCCACCGGGTCCGGTGAGGTTGCCGTCGCGTACCACGTGGTGACGGTCGACGGGCGG
GACGCCTCCGGCATCGCCCGGTTCACGGTGGGCGCGCCGGGCGGGGCGCCGCCGCCCGAG
CCCCCGGCGCCGGCCCACGCCCACGGGATCGACCCGGTCGGCGCTGCCCTGCTCGCCGTC
GACGGTCTCGCGCTCCTCGCCGTGCTCGTGCTGCTCGCGCGGCGCTCCCGCACCGACCGC
GACATCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007348 CopC domain (Domain)
 [39-131]  1.4e-11 PF04234
PF04234   CopC
IPR014755 Copper resistance protein CopC/internalin, immunoglobulin-like (Domain)
 [39-131]  3.2e-11 G3DSA:2.60.40.1220
G3DSA:2.60.40.1220   Cu-resist/internalin_Ig-like
IPR014756 Immunoglobulin E-set (Domain)
 [36-131]  1.89999859865864e-12 SSF81296
SSF81296   Ig_E-set
SignalP
 [1-34]  0.582 Signal
Bacteria, Gram-positive   
 [1-25]  0.753 Signal
Eukaryota   
TMHMM
 [7-26]  Transmembrane (i-o) [153-172]  Transmembrane (o-i)
Transmembrane 2