close all open/close all

CDS information : Calm_00730


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction88,853 / 87,351 / - [in whole cluster]
88,853 / 87,351 / - [in contig]
Locationcomplement(87351..88853) [in whole cluster]
complement(87351..88853) [in contig]
TypeCDS
Length1,503 bp (500 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Productputative methyltransferase
Product (GenBank)CalU22
Gene
Gene (GenBank)calU22
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)
Related Reference
ACC
A0A007
PmId
[17379141] A streamlined metabolic pathway for the biosynthesis of moenomycin A. (Chem Biol. , 2007)

close this sectionSequence

selected fasta
>putative methyltransferase [CalU22]
MGLRDVSVLLLYPPNQTAPGTVCKPNGSLAYPNLGGALREHGVHVRVFDACVGEGADPLD
DIFANPTPMPSGFLRTGVSDERILEVVKDHDIVGITSIFTDQETMVLHCARLIRAAYPEK
LLVTGGVNARSRLPQFFGAGFDVVCLSEAERTIIDIVEAVRRSPHPSFADIHGVAFLDDG
RIRMNPARAQDVVWDLDTLPMPAWDLLPNERYWTIARPHSGLFEPGAELRYATMMTSLGC
PFRCAYCHIAGEQEGNPSGPIGKFRVKSDERVLAEIETLKSLGVDNVFIEDDSLLGDKRR
GLRLLKKIQGAGVTICDLNGINLIHLLKRWKPDHEVLEAMADAGFTQINMPFESGNLRII
RKYASNKLNIEKADLPGLIVAMKEYGFQIYGNYMMGYPDETLEEIETTIQLAKEHVSYGL
DAANFFLVVPLPGAPLFDMAIAGGHISPDFDPDTMNIYRANMTGTLVPAEVLEELRHRAW
DEVNSPTWKNAKKAWAATAS
selected fasta
>putative methyltransferase [CalU22]
ATGGGTCTTCGTGACGTCAGCGTGCTGCTGCTGTACCCGCCGAACCAGACCGCCCCCGGC
ACGGTGTGCAAGCCGAACGGATCGCTCGCGTACCCGAATCTGGGCGGAGCCCTGCGGGAG
CACGGTGTGCACGTTCGCGTCTTCGACGCCTGCGTCGGCGAGGGCGCCGACCCGCTCGAC
GACATCTTCGCCAACCCCACGCCGATGCCGAGCGGTTTCCTCCGCACCGGCGTCAGCGAC
GAGCGGATCCTCGAGGTGGTGAAGGACCACGACATCGTCGGCATCACCTCGATCTTCACC
GACCAGGAGACGATGGTCCTGCACTGCGCGCGGCTCATCCGGGCGGCCTACCCGGAGAAG
CTGCTCGTCACCGGCGGGGTCAACGCGCGGTCGCGGTTGCCGCAGTTCTTCGGGGCGGGC
TTCGACGTGGTCTGCCTGTCCGAGGCCGAGCGCACGATCATCGACATCGTCGAGGCCGTA
CGACGGTCGCCGCACCCGAGCTTCGCCGACATCCACGGTGTCGCCTTCCTCGACGACGGC
CGGATCCGGATGAACCCCGCGCGGGCGCAGGACGTCGTGTGGGACCTGGACACCCTGCCC
ATGCCGGCCTGGGACCTGCTGCCCAACGAACGGTACTGGACGATCGCCCGGCCGCACTCC
GGTCTCTTCGAGCCCGGCGCCGAGCTGCGGTACGCGACCATGATGACCTCGCTCGGCTGC
CCGTTCCGCTGCGCGTACTGCCACATCGCCGGCGAGCAGGAGGGGAACCCCAGCGGCCCG
ATCGGCAAGTTCCGCGTCAAGTCGGACGAGCGGGTGCTGGCGGAGATCGAGACGCTGAAG
AGCCTGGGCGTCGACAACGTGTTCATCGAGGACGACTCGCTCCTGGGCGACAAGCGGCGC
GGCCTCCGGCTGCTCAAGAAGATCCAGGGCGCTGGCGTGACCATCTGCGACCTCAACGGC
ATCAACCTCATCCACCTGCTCAAGCGCTGGAAGCCCGACCACGAGGTCCTGGAGGCGATG
GCCGACGCGGGCTTCACGCAGATCAACATGCCCTTCGAGTCGGGCAACCTGCGGATCATC
CGCAAGTACGCGAGCAACAAGCTCAACATCGAGAAGGCCGACCTGCCCGGGCTGATCGTC
GCCATGAAGGAGTACGGCTTCCAGATCTACGGCAACTACATGATGGGTTACCCGGACGAG
ACGCTGGAGGAGATCGAGACGACCATCCAGCTCGCCAAGGAGCACGTCTCCTACGGGCTG
GACGCCGCGAACTTCTTCCTCGTCGTGCCGCTGCCCGGCGCGCCGTTGTTCGACATGGCG
ATCGCGGGCGGCCACATCAGCCCCGACTTCGACCCGGACACGATGAACATCTACCGGGCC
AACATGACCGGCACCCTGGTGCCGGCAGAGGTCCTGGAGGAGCTGCGCCACCGAGCCTGG
GACGAGGTGAACTCGCCGACCTGGAAGAACGCCAAGAAGGCGTGGGCGGCGACGGCCAGC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006158 Cobalamin (vitamin B12)-binding (Domain)
 [6-167]  PS51332
PS51332   B12_BINDING
 [34-155]  1.6e-10 PF02310
PF02310   B12-binding
IPR006638 Elongator protein 3/MiaB/NifB (Domain)
 [230-460]  2.19999900980708e-20 SM00729
SM00729   Elp3
IPR007197 Radical SAM (Domain)
 [236-411]  1.4e-13 PF04055
PF04055   Radical_SAM
IPR023404 Radical SAM, alpha/beta horseshoe (Domain)
 [230-461]  3.90000000000001e-32 G3DSA:3.80.30.20
G3DSA:3.80.30.20   G3DSA:3.80.30.20
SignalP No significant hit
TMHMM No significant hit