close all open/close all
Calm_00730 Calm_00730   last last

CDS information : Calm_00740


close this sectionLocation

Organism
StrainNRRL 15839
Entry nameCalicheamicin
Contig
Start / Stop / Direction90,348 / 89,143 / - [in whole cluster]
90,348 / 89,143 / - [in contig]
Locationcomplement(89143..90348) [in whole cluster]
complement(89143..90348) [in contig]
TypeCDS
Length1,206 bp (401 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productglycosyltransferase
Product (GenBank)CalG4
Gene
Gene (GenBank)calG4
EC number
Keyword
  • aminodideoxypentose
Note
Note (GenBank)
Reference
ACC
PmId
[12183629] The calicheamicin gene cluster and its iterative type I enediyne PKS. (Science. , 2002)
[16946071] Exploiting the reversibility of natural product glycosyltransferase-catalyzed reactions. (Science. , 2006)
[21987796] Complete set of glycosyltransferase structures in the calicheamicin biosynthetic pathway reveals the origin of regiospecificity. (Proc Natl Acad Sci U S A. , 2011)

close this sectionSequence

selected fasta
>glycosyltransferase [CalG4]
MRQRHILFANVQGHGHVYPSLGLVSELARRGHRITYVTTPLFADEVKAAGAEVVLYKSEF
DTFHVPEVVKQEDAETQLHLVYVRENVAILRAAEEALGDNPPDLVVYDVFPFIAGRLLAA
RWDRPAVRLTGGFAANEHYSLFKELWKSNGQRHPADVEAVHSVLVDLLGKYGVDTPVKEY
WDEIEGLTIVFLPKSFQPFAETFDERFAFVGPTLTGRDGQPGWQPPRPDAPVLLVSLGNQ
FNEHPEFFRACAQAFADTPWHVVMAIGGFLDPAVLGPLPPNVEAHQWIPFHSVLAHARAC
LTHGTTGAVLEAFAAGVPLVLVPHFATEAAPSAERVIELGLGSVLRPDQLEPASIREAVE
RLAADSAVRERVRRMQRDILSSGGPARAADEVEAYLGRVAP
selected fasta
>glycosyltransferase [CalG4]
ATGCGCCAGCGTCACATCCTCTTCGCCAACGTCCAGGGTCACGGTCACGTCTACCCGTCG
CTCGGCCTCGTCAGCGAGCTGGCCCGGCGAGGGCACCGGATCACGTACGTGACGACGCCG
CTGTTCGCCGACGAGGTCAAGGCCGCCGGCGCCGAGGTCGTGCTGTACAAGTCCGAGTTC
GACACCTTCCACGTGCCCGAGGTCGTCAAGCAGGAGGACGCCGAGACGCAACTGCACCTG
GTGTACGTCCGCGAGAACGTGGCCATCCTGCGGGCCGCCGAGGAGGCGCTGGGGGACAAC
CCGCCCGACCTCGTGGTCTACGACGTGTTCCCGTTCATCGCGGGGCGCCTCCTGGCCGCC
CGGTGGGACCGGCCGGCCGTACGCCTCACCGGCGGCTTCGCCGCGAACGAGCACTACTCG
CTGTTCAAGGAGCTGTGGAAGAGCAACGGCCAACGCCACCCGGCCGACGTCGAGGCCGTG
CACTCGGTGCTCGTCGACCTGCTCGGGAAGTACGGCGTCGACACCCCGGTCAAGGAGTAC
TGGGACGAGATCGAGGGCCTCACCATCGTCTTCCTGCCGAAGTCGTTCCAGCCCTTCGCC
GAGACCTTCGACGAGCGGTTCGCGTTCGTCGGGCCCACCCTCACCGGCCGCGACGGCCAG
CCCGGCTGGCAGCCGCCACGGCCGGACGCGCCGGTGCTGCTGGTCTCGCTCGGCAACCAG
TTCAACGAGCACCCCGAGTTCTTCCGCGCCTGCGCGCAGGCCTTCGCCGACACCCCCTGG
CACGTGGTCATGGCGATCGGCGGCTTCCTCGACCCGGCGGTGCTGGGCCCGTTGCCGCCC
AATGTCGAGGCGCACCAGTGGATCCCGTTCCACTCCGTGCTCGCGCACGCCAGGGCGTGC
CTGACGCACGGCACCACCGGCGCCGTGCTGGAGGCCTTCGCCGCGGGCGTGCCCCTGGTG
CTCGTGCCGCACTTCGCGACCGAGGCCGCCCCGTCCGCGGAGCGCGTCATCGAGTTGGGC
CTGGGCTCCGTGCTGCGGCCGGACCAGCTCGAACCGGCCAGCATCCGGGAGGCCGTGGAG
CGGCTCGCGGCCGACTCCGCTGTCAGGGAGCGGGTGCGCCGGATGCAGCGCGACATCCTC
TCGTCCGGTGGGCCGGCCCGGGCGGCGGACGAGGTCGAGGCGTACCTGGGGCGGGTCGCG
CCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002213 UDP-glucuronosyl/UDP-glucosyltransferase (Family)
 [231-375]  8.60000000000001e-13 PF00201
PF00201   UDPGT
IPR004276 Glycosyl transferase, family 28 (Domain)
 [15-105]  9.9e-08 PF03033
PF03033   Glyco_transf_28
IPR006326 UDP-glycosyltransferase, MGT (Family)
 [10-396]  8.1e-115 TIGR01426
TIGR01426   MGT
SignalP No significant hit
TMHMM No significant hit
Calm_00730 Calm_00730   last last