close all open/close all
first first   Chalc_00020 Chalc_00020

CDS information : Chalc_00010


close this sectionLocation

Organism
StrainNRRL 2737
Entry nameChalcomycin
Contig
Start / Stop / Direction1,009 / 2 / - [in whole cluster]
1,009 / 2 / - [in contig]
Locationcomplement(2..1009) [in whole cluster]
complement(2..1009) [in contig]
TypeCDS
Length1,008 bp (335 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein(fragment)
Product (GenBank)conserved hypothetical protein
Gene
Gene (GenBank)ORF1
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in chalcomycin biosynthesis.
Note (GenBank)
  • similar to Streptomyces coelicolor SCO0450
Reference
ACC
PmId
[15561847] Chalcomycin biosynthesis gene cluster from Streptomyces bikiniensis: novel features of an unusual ketolide produced through expression of the chm polyketide synthase in Streptomyces fradiae. (Antimicrob Agents Chemother. , 2004)

close this sectionSequence

selected fasta
>hypothetical protein(fragment) [conserved hypothetical protein]
MADVLDIRQYRSPAATALMSLAVAVLYYAAGRLGLMGRLVVEGVVVTPIWPPTGVAVAAL
LLLGARVWPGIALGSFLVIASLTTPGPTTVVTVVSNTVAPLCAFLLLTRAGFRLDMARLR
DGLSLVFLGGFGAMLISATAGVGLQVAKSSLDTTEFWPVWLAWWVGDTMGVLLVAPLLLV
LAGPAGRFRVRRWKEAALLGLATLILMPMAVLSPVGMLFLVFPLLIWAALRFQLTGSMLC
ALFASVLATFEANAGRGGFLHLSDVEIMAKLQAFNGSAALTALLLASVITEQRATRRSVR
RACRELAEVLEHLAAGEPAPGPPGTAESRAAPSGGP
selected fasta
>hypothetical protein(fragment) [conserved hypothetical protein]
ATGGCAGACGTGTTGGATATTCGGCAGTACCGGTCCCCCGCGGCGACGGCGCTGATGTCG
CTGGCCGTGGCGGTGCTCTACTACGCGGCCGGACGACTCGGCCTGATGGGCCGCCTCGTC
GTCGAAGGCGTGGTGGTCACCCCCATCTGGCCTCCCACCGGCGTCGCCGTCGCCGCCCTG
CTGCTGCTCGGCGCGCGCGTCTGGCCCGGGATCGCCCTCGGCTCCTTCCTCGTCATCGCC
TCCCTCACCACGCCGGGGCCCACCACCGTGGTCACCGTGGTCAGCAACACCGTCGCGCCG
CTCTGCGCCTTCCTGCTGCTGACACGGGCCGGCTTCCGGCTCGACATGGCACGGCTGCGG
GACGGACTCTCCCTGGTCTTCCTCGGCGGGTTCGGCGCCATGCTGATCAGCGCGACCGCC
GGGGTCGGACTGCAGGTGGCGAAGAGCTCCCTGGACACGACCGAGTTCTGGCCCGTCTGG
CTGGCCTGGTGGGTGGGCGACACGATGGGGGTGCTGCTCGTCGCCCCGCTCCTCCTCGTC
CTCGCGGGGCCGGCCGGACGGTTCCGCGTACGGCGCTGGAAGGAGGCGGCCCTGCTGGGT
CTCGCGACCCTGATCCTCATGCCCATGGCCGTGCTCAGCCCGGTGGGCATGCTCTTCCTC
GTCTTCCCCCTGCTGATCTGGGCGGCGCTCCGCTTCCAGCTCACCGGAAGCATGCTCTGC
GCGCTCTTCGCCTCCGTGCTCGCCACCTTCGAGGCGAACGCCGGACGGGGAGGGTTCCTC
CACCTCTCGGACGTCGAGATCATGGCCAAGCTCCAGGCGTTCAACGGTTCCGCCGCACTG
ACCGCCCTGCTTCTCGCCTCCGTCATCACGGAGCAGCGTGCGACCCGCCGCTCGGTACGC
CGCGCCTGCCGGGAACTGGCGGAGGTCCTGGAGCATCTCGCCGCGGGCGAGCCCGCACCC
GGCCCACCGGGCACCGCCGAGAGCCGGGCAGCCCCGTCCGGCGGGCCC

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007895 MASE1 (Domain)
 [19-293]  2.59999999999998e-42 PF05231
PF05231   MASE1
SignalP
 [1-1]  Signal-anchor
Eukaryota   
TMHMM
 [13-35]  Transmembrane (i-o) [40-62]  Transmembrane (o-i) [67-86]  Transmembrane (i-o) [90-112]  Transmembrane (o-i) [124-146]  Transmembrane (i-o) [161-183]  Transmembrane (o-i) [196-218]  Transmembrane (i-o) [228-250]  Transmembrane (o-i)
Transmembrane 8   
first first   Chalc_00020 Chalc_00020