close all open/close all

CDS information : Chalc_00020


close this sectionLocation

Organism
StrainNRRL 2737
Entry nameChalcomycin
Contig
Start / Stop / Direction1,963 / 1,121 / - [in whole cluster]
1,963 / 1,121 / - [in contig]
Locationcomplement(1121..1963) [in whole cluster]
complement(1121..1963) [in contig]
TypeCDS
Length843 bp (280 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)conserved hypothetical protein
Gene
Gene (GenBank)ORF2
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in chalcomycin biosynthesis.
Note (GenBank)
  • similar to Streptomyces coelicolor SCO0451
Reference
ACC
PmId
[15561847] Chalcomycin biosynthesis gene cluster from Streptomyces bikiniensis: novel features of an unusual ketolide produced through expression of the chm polyketide synthase in Streptomyces fradiae. (Antimicrob Agents Chemother. , 2004)

close this sectionSequence

selected fasta
>hypothetical protein [conserved hypothetical protein]
MFRRRPADSSEDLLVRLGSLTARARELAETQRSRVELAVALQRGMLPSDLPSLPGARLAV
RYEPANHGLNVGGDWYDAFPLPGGRIGMSIGDVQGHNIEAAAFMGQVRVALRALASVTAD
PGELLGRTNDLLVSLGADLFATCTFLRLDPAAGTLECARAGHIPHIWATADGRSGIDDSE
GGPPLGVLRGADYPATRHRLTADGVFVLLTDGVVEGPSLHIDEGLDRVTRLAGITAVAGL
DVDALATAVMRLAATVGHEDDAAVLVVGHDGGPPRPATGE
selected fasta
>hypothetical protein [conserved hypothetical protein]
ATGTTCCGCAGACGCCCGGCCGACAGCAGCGAGGACCTTCTGGTCCGGCTCGGGTCGCTG
ACCGCCAGGGCGCGGGAGCTGGCCGAGACGCAGCGGTCCCGTGTCGAGCTCGCCGTGGCC
CTGCAGCGCGGCATGCTGCCCTCGGACCTGCCCAGTCTTCCGGGTGCCCGGCTGGCCGTC
CGGTACGAGCCCGCCAACCACGGGCTCAACGTCGGCGGCGACTGGTACGACGCCTTCCCC
CTGCCTGGCGGGCGGATCGGCATGTCCATCGGCGACGTCCAGGGACACAACATCGAGGCC
GCCGCCTTCATGGGACAGGTCCGCGTGGCACTGCGCGCGCTGGCCTCCGTCACCGCGGAC
CCGGGAGAGCTGCTCGGCCGCACCAACGACCTGCTCGTCTCCCTCGGCGCCGACCTCTTC
GCCACCTGCACCTTCCTGCGGCTCGACCCCGCCGCCGGCACCCTGGAATGCGCCCGGGCC
GGCCACATCCCCCACATCTGGGCCACCGCCGACGGCCGCTCCGGCATCGACGACAGCGAG
GGCGGGCCTCCTCTCGGCGTGCTGCGCGGCGCCGACTACCCGGCCACGCGCCACCGGCTC
ACCGCCGACGGCGTCTTCGTCCTCCTGACCGACGGGGTCGTGGAGGGGCCCTCGCTCCAC
ATCGACGAGGGTCTCGACCGGGTGACGAGACTCGCCGGGATCACGGCCGTCGCCGGGCTG
GACGTCGACGCGCTCGCCACCGCCGTCATGCGACTGGCGGCCACGGTGGGGCACGAGGAC
GACGCGGCCGTCCTCGTCGTCGGCCACGACGGCGGTCCGCCCCGGCCGGCGACCGGGGAG
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001932 Protein phosphatase 2C-like (Domain)
 [56-269]  3.1999989904635e-28 SM00331
SM00331   PP2C_SIG
 [82-268]  5.59999999999999e-42 PF07228
PF07228   SpoIIE
SignalP
 [1-24]  0.237 Signal
Bacteria, Gram-negative   
TMHMM No significant hit