close all open/close all

CDS information : Chalc_00030


close this sectionLocation

Organism
StrainNRRL 2737
Entry nameChalcomycin
Contig
Start / Stop / Direction3,889 / 3,008 / - [in whole cluster]
3,889 / 3,008 / - [in contig]
Locationcomplement(3008..3889) [in whole cluster]
complement(3008..3889) [in contig]
TypeCDS
Length882 bp (293 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)conserved hypothetical protein
Gene
Gene (GenBank)ORF3
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in chalcomycin biosynthesis.
Note (GenBank)
  • putative oxidoreductase; similar to Streptomyces coelicolor SCO0299, Mycobacterium leprae ML0458, and Deinococcus radiodurans DR1890
Reference
ACC
PmId
[15561847] Chalcomycin biosynthesis gene cluster from Streptomyces bikiniensis: novel features of an unusual ketolide produced through expression of the chm polyketide synthase in Streptomyces fradiae. (Antimicrob Agents Chemother. , 2004)
Related Reference
ACC
Q9X5G7
PmId
[10223939] Genes specific for the biosynthesis of clavam metabolites antipodal to clavulanic acid are clustered with the gene for clavaminate synthase 1 in Streptomyces clavuligerus. (Antimicrob Agents Chemother. , 1999)
Family/Domain
FD
IPR020471

close this sectionSequence

selected fasta
>putative oxidoreductase [conserved hypothetical protein]
MAQPGRTTFPLGGDLSVHRLGFGALRLTGPGYWGPPEDREAAISTARLAVDLGVSFIDTA
DSYGLGSNEELLAEALRPYPDGLVIATKAGQCRPRPDQWVPCGRPEYLRQQAELSLRRLR
LDRIDLFQLHRIDPKVPAAEQFGALGELQDEGKIRHIGLSKVTVREVEAAREHITVASVQ
NVYNLTDRRNDEVVEYCEKHEIAFIAWLPIARGALAAGGSPVADIATELEVSAGQVALAW
LLHRSPAVIPIPGTSSPAHLRENVAASGIALSDGQLARLNALGRTHDDATVPV
selected fasta
>putative oxidoreductase [conserved hypothetical protein]
ATGGCACAGCCCGGCAGGACCACCTTCCCTCTGGGAGGCGACCTCTCGGTACACCGGTTG
GGTTTCGGCGCCCTCCGGCTGACCGGTCCGGGGTACTGGGGCCCGCCGGAGGACCGGGAG
GCTGCGATCAGCACGGCCCGGCTGGCCGTGGACCTCGGTGTGTCCTTCATCGACACGGCC
GATTCCTACGGGCTGGGAAGCAACGAGGAGCTGCTGGCCGAAGCACTGCGCCCGTACCCC
GACGGCCTCGTGATCGCGACGAAGGCCGGACAGTGCCGGCCCCGTCCCGACCAGTGGGTG
CCGTGCGGCCGACCGGAGTACCTCCGCCAGCAGGCCGAGCTGAGCCTGCGCAGGCTGCGA
CTCGACCGCATCGACCTCTTCCAGCTGCACCGGATCGATCCGAAGGTGCCGGCGGCCGAG
CAGTTCGGTGCGCTCGGGGAACTGCAGGACGAAGGGAAGATCCGGCACATCGGGCTGTCC
AAGGTCACCGTCCGGGAAGTGGAGGCCGCCCGTGAGCACATCACCGTGGCCAGCGTGCAG
AACGTGTACAACCTGACCGACCGGCGCAACGACGAGGTGGTCGAGTACTGCGAGAAGCAC
GAGATCGCGTTCATCGCCTGGCTGCCGATCGCCCGCGGTGCGCTCGCCGCCGGGGGGAGC
CCGGTGGCCGACATCGCCACCGAGCTGGAGGTGTCGGCCGGTCAGGTGGCGCTCGCGTGG
CTGCTGCACCGCTCGCCGGCGGTCATTCCCATCCCCGGCACCAGCTCGCCCGCGCATCTG
AGGGAGAACGTCGCGGCGTCGGGCATCGCTCTCTCCGATGGCCAGCTGGCCCGGCTGAAC
GCGCTCGGACGCACGCACGACGACGCCACGGTGCCCGTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR020471 Aldo/keto reductase subgroup (Family)
 [49-73]  2.89999717862184e-10 PR00069 [114-132]  2.89999717862184e-10 PR00069 [145-162]  2.89999717862184e-10 PR00069 [178-207]  2.89999717862184e-10 PR00069 [216-240]  2.89999717862184e-10 PR00069
PR00069   ALDKETRDTASE
IPR023210 NADP-dependent oxidoreductase domain (Domain)
 [13-282]  2.99999999999998e-74 G3DSA:3.20.20.100
G3DSA:3.20.20.100   Aldo/ket_red
 [6-286]  1.59998835313644e-77 SSF51430
SSF51430   Aldo/ket_red
 [19-282]  1.99999999999999e-64 PF00248
PF00248   Aldo_ket_red
SignalP No significant hit
TMHMM No significant hit