close all open/close all

CDS information : Chalc_00040


close this sectionLocation

Organism
StrainNRRL 2737
Entry nameChalcomycin
Contig
Start / Stop / Direction5,208 / 3,991 / - [in whole cluster]
5,208 / 3,991 / - [in contig]
Locationcomplement(3991..5208) [in whole cluster]
complement(3991..5208) [in contig]
TypeCDS
Length1,218 bp (405 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-4 aminotransferase
Product (GenBank)putative D-chalcose pathway component
Gene
Gene (GenBank)chmCIV
EC number2.6.1.-
Keyword
  • D-chalcose
Note
Note (GenBank)
  • predicted to participate with ChmCV in production of 4-deoxy in D-chalcose pathway; similar to EryCIV, OleN1
Reference
ACC
PmId
[15561847] Chalcomycin biosynthesis gene cluster from Streptomyces bikiniensis: novel features of an unusual ketolide produced through expression of the chm polyketide synthase in Streptomyces fradiae. (Antimicrob Agents Chemother. , 2004)
Related Reference
ACC
Q331S0
PmId
[17532307] Enzymatic synthesis of dTDP-4-amino-4,6-dideoxy-D-glucose using GerB (dTDP-4-keto-6-deoxy-D-glucose aminotransferase). (Carbohydr Res. , 2007)
ACC
Q9ZGH0
NITE
Pikro_00160
PmId
[17630700] Molecular architecture of DesI: a key enzyme in the biosynthesis of desosamine. (Biochemistry. , 2007)

close this sectionSequence

selected fasta
>putative NDP-hexose C-4 aminotransferase [putative D-chalcose pathway component]
MTMKRNLGDLAVFGGPSAFLQPLHVGRPNVGDRARFLDRVNWALDHQWLTNGGPLAREFE
QRVAELAGVRYCVSTCNATVALQLLARAADLSGEVIMPSLTFPATAQAFRWLGLTPVFVD
IDPATNCLDPDLIEAAITPRTSAVVPVHLWGRPCAVDRLAKVAADHGLRLFYDAAHGLGC
TSEGQPIGGFGQAEVFSFHATKVVNAFEGGAVVTDDERLAQRVRAMHNFGFTQGRVSTET
GTNGKMTEAAAAMGLTSLDAFEETVRRNEANHDDYRSELAGLAGLKVMEFDRAERNNYHY
LVVEVDAAVTGVHRDLLDEVLRAENIMCQRYFSPGCHEMEPYRSERPVSLPHTERLARKV
LALPTGPTVSREDIRRVCDIVRLTLERGHEVTRRADERVPSTTAP
selected fasta
>putative NDP-hexose C-4 aminotransferase [putative D-chalcose pathway component]
ATGACCATGAAACGCAATCTCGGTGATCTCGCCGTGTTCGGCGGCCCGTCGGCGTTCCTG
CAACCACTTCACGTGGGGCGGCCCAACGTGGGCGACCGAGCGCGGTTCCTGGACCGTGTG
AACTGGGCGCTGGACCACCAGTGGCTGACCAACGGCGGGCCGCTGGCCCGGGAGTTCGAG
CAGCGCGTGGCGGAACTCGCCGGCGTGCGCTACTGCGTGTCGACCTGCAACGCGACCGTC
GCCCTCCAGTTGCTGGCCCGCGCCGCCGATCTGTCGGGCGAGGTCATCATGCCGTCGCTG
ACCTTCCCGGCGACCGCCCAGGCGTTCCGCTGGCTGGGTCTGACCCCGGTCTTCGTCGAC
ATCGACCCGGCCACCAACTGCCTGGACCCGGATCTGATCGAGGCGGCGATCACCCCCCGT
ACGAGTGCGGTCGTGCCGGTCCATCTGTGGGGTCGGCCCTGCGCGGTCGACCGGCTGGCG
AAGGTCGCGGCCGATCACGGTCTCAGGCTCTTCTACGATGCCGCGCACGGACTCGGCTGC
ACGTCGGAAGGGCAGCCGATCGGCGGCTTCGGACAAGCCGAGGTGTTCAGCTTCCACGCC
ACCAAGGTGGTCAACGCCTTCGAGGGCGGCGCGGTGGTGACCGATGACGAGAGGCTGGCC
CAGCGGGTCCGCGCGATGCACAACTTCGGATTCACCCAGGGGCGGGTGTCCACGGAGACC
GGCACCAACGGGAAGATGACCGAAGCCGCCGCCGCGATGGGACTCACCTCGCTCGACGCC
TTCGAGGAGACGGTTCGCCGGAACGAGGCCAACCACGACGACTACCGGTCGGAACTCGCC
GGGCTCGCCGGGCTGAAGGTCATGGAGTTCGACCGTGCCGAGCGCAACAACTACCACTAT
CTGGTCGTGGAGGTCGACGCCGCGGTGACCGGGGTCCACCGGGACCTGCTGGACGAGGTG
CTGAGGGCGGAGAACATCATGTGCCAGCGGTACTTCTCCCCCGGATGCCACGAGATGGAG
CCCTACCGCTCGGAGCGGCCGGTCTCCCTGCCCCACACCGAACGGCTCGCGCGGAAGGTC
CTCGCCCTGCCCACCGGCCCCACCGTCTCTCGCGAGGACATCCGTCGGGTCTGCGACATC
GTGCGGCTCACTCTGGAGCGGGGACACGAGGTGACCCGACGGGCCGACGAGCGGGTGCCC
TCCACGACGGCTCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000653 DegT/DnrJ/EryC1/StrS aminotransferase (Family)
 [2-389]  PIRSF000390
PIRSF000390   PLP_StrS
 [34-382]  2.50000000000001e-106 PF01041
PF01041   DegT_DnrJ_EryC1
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [23-259]  2.09999999999996e-69 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [262-387]  1.3e-28 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [21-386]  1.90000694315261e-90 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP No significant hit
TMHMM No significant hit