close all open/close all

CDS information : Chalc_00050


close this sectionLocation

Organism
StrainNRRL 2737
Entry nameChalcomycin
Contig
Start / Stop / Direction6,118 / 5,339 / - [in whole cluster]
6,118 / 5,339 / - [in contig]
Locationcomplement(5339..6118) [in whole cluster]
complement(5339..6118) [in contig]
TypeCDS
Length780 bp (259 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose O-methyltransferase
Product (GenBank)putative O-methyltransferase in D-chalcose pathway
Gene
Gene (GenBank)chmCI
EC number2.1.1.-
Keyword
  • D-chalcose
Note
Note (GenBank)
  • similar to SpnH
Reference
ACC
PmId
[15561847] Chalcomycin biosynthesis gene cluster from Streptomyces bikiniensis: novel features of an unusual ketolide produced through expression of the chm polyketide synthase in Streptomyces fradiae. (Antimicrob Agents Chemother. , 2004)
Related Reference
ACC
Q9ALM9
NITE
Spino_00140
PmId
[20158237] Biosynthesis of spinosyn in Saccharopolyspora spinosa: synthesis of permethylated rhamnose and characterization of the functions of SpnH, SpnI, and SpnK. (J Am Chem Soc. , 2010)
ACC
Q9AJU0
NITE
Ello_00200
PmId
[11376004] Deoxysugar methylation during biosynthesis of the antitumor polyketide elloramycin by Streptomyces olivaceus. Characterization of three methyltransferase genes. (J Biol Chem. , 2001)

close this sectionSequence

selected fasta
>putative NDP-hexose O-methyltransferase [putative O-methyltransferase in D-chalcose pathway]
MKNVVSNTIYGDHPTFPVGMNVLDKELADRMRPGAEGPDVERGTFDADHRAEGLDVPTVA
HTMIGLQRLDNIQRCVERVLQDDVPGDLIETGVWRGGACILMRALLKAHGVEDRTVWLAD
SFAGVPVTSEDSHPLDRAMEFHHLNWVLSCSEEQVRENFARYGLLDEQVRFLPGMFADTL
PTAPIDRLAVLRVDGDLYESTRDALVNLYPKLSVGGFVIVDDYLIPACKQAVHDYRSEHG
IDEPIETVDVTGVYWRREH
selected fasta
>putative NDP-hexose O-methyltransferase [putative O-methyltransferase in D-chalcose pathway]
ATGAAGAACGTCGTGTCGAACACCATCTACGGGGATCACCCGACCTTCCCGGTCGGGATG
AACGTCCTGGACAAGGAACTGGCGGACCGCATGCGTCCGGGGGCGGAGGGCCCGGACGTC
GAGCGCGGGACCTTCGACGCCGACCACCGGGCCGAAGGACTGGACGTGCCGACGGTCGCG
CACACCATGATCGGCCTGCAACGCCTGGACAACATCCAGAGGTGCGTGGAGAGGGTCCTC
CAGGACGATGTTCCCGGTGATCTCATCGAGACCGGCGTGTGGCGCGGCGGCGCCTGCATC
CTGATGCGCGCGCTCCTCAAGGCGCACGGTGTGGAGGACCGCACCGTGTGGCTCGCCGAC
TCGTTCGCCGGTGTCCCGGTGACGTCCGAGGACAGCCACCCGCTCGACCGGGCGATGGAG
TTCCACCACCTGAACTGGGTACTGAGCTGTTCCGAGGAGCAGGTGAGGGAGAACTTCGCC
CGCTACGGCCTGCTGGACGAGCAGGTCAGGTTCCTGCCCGGCATGTTCGCCGACACGCTG
CCGACCGCGCCGATCGACCGGCTCGCGGTGCTGCGGGTGGACGGCGACCTGTACGAGTCG
ACGAGGGACGCGCTGGTCAACCTCTACCCCAAGCTGTCCGTGGGCGGGTTCGTGATCGTG
GACGACTACCTGATCCCGGCGTGCAAGCAGGCCGTCCACGACTACCGGAGCGAACACGGC
ATCGACGAGCCGATCGAGACGGTGGACGTGACGGGCGTCTACTGGCGCCGCGAGCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR008884 Macrocin-O-methyltransferase (Family)
 [1-258]  7.09999999999991e-122 PF05711
PF05711   TylF
SignalP No significant hit
TMHMM No significant hit