close all open/close all

CDS information : Chalc_00060


close this sectionLocation

Organism
StrainNRRL 2737
Entry nameChalcomycin
Contig
Start / Stop / Direction7,696 / 6,239 / - [in whole cluster]
7,696 / 6,239 / - [in contig]
Locationcomplement(6239..7696) [in whole cluster]
complement(6239..7696) [in contig]
TypeCDS
Length1,458 bp (485 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative SAM-dependent NDP-hexose C-4 deaminase
Product (GenBank)putative D-chalcose pathway component
Gene
Gene (GenBank)chmCV
EC number
Keyword
  • D-chalcose
Note
Note (GenBank)
  • predicted to participate with ChmCIV in production of 4-deoxy in D-chalcose pathway; similar to EryCV, NbmJ and DesII
Reference
ACC
PmId
[15561847] Chalcomycin biosynthesis gene cluster from Streptomyces bikiniensis: novel features of an unusual ketolide produced through expression of the chm polyketide synthase in Streptomyces fradiae. (Antimicrob Agents Chemother. , 2004)
Related Reference
ACC
Q9ZGH1
NITE
Pikro_00150
PmId
[19746907] Characterization and mechanistic studies of DesII: a radical S-adenosyl-L-methionine enzyme involved in the biosynthesis of TDP-D-desosamine. (J Am Chem Soc. , 2009)
[20121093] Stoichiometry of the redox neutral deamination and oxidative dehydrogenation reactions catalyzed by the radical SAM enzyme DesII. (J Am Chem Soc. , 2010)
[23329328] EPR-kinetic isotope effect study of the mechanism of radical-mediated dehydrogenation of an alcohol by the radical SAM enzyme DesII. (Proc Natl Acad Sci U S A. , 2013)

close this sectionSequence

selected fasta
>putative SAM-dependent NDP-hexose C-4 deaminase [putative D-chalcose pathway component]
MTSHASTAADPVALCARPGADLPAAVHTVHRALVSDGRVGVDEGPTVARRLVRLAERYGN
HPFTPLEEARRMLDVDRASFGRLLGLFGRVPELRHAVENGPAGKYWQNTLLPLERRGVFD
AALAHKPAFPYVVGLYPGPSCMFRCHFCVRVTGARYDPSALESGNAMFASVIDEIPAGNP
YAMYFSGGLEPLTNPGLGALSSRAAARGLRPTVYTNSFALTERTLDRQPGVWDLHAVRTS
LYGLNDEEYEETTGKRAAFGRVRANLRRFQQLRSERESPIRLGLSYIVLPGRVHRLLDLV
DFIADLNEAAPDRPVDFLNVREDYSGREDGRLFEAERAELQEGLLAFEEAVSRRTPTLNI
DYGYALHSLKTGADAELLRIRPGTMRRSAHPQVSVQVDLLGDVYLYREAGFPDLTGADRY
VAGRVGPGTSLTEVVERFVDDGRLIAPHAGDEYFMDGFDQVVAARLNQLEADVVAGWEDA
RGFLR
selected fasta
>putative SAM-dependent NDP-hexose C-4 deaminase [putative D-chalcose pathway component]
ATGACCTCGCACGCCTCCACCGCGGCCGATCCGGTCGCCCTGTGCGCCCGCCCCGGCGCC
GACCTGCCGGCAGCGGTCCACACGGTGCACCGCGCCCTGGTCTCCGACGGCCGCGTCGGT
GTCGACGAGGGCCCGACGGTCGCGCGCCGGCTCGTGCGGCTGGCCGAGCGCTACGGGAAC
CACCCCTTCACGCCCCTGGAGGAGGCACGCCGGATGCTGGACGTGGACCGGGCCTCCTTC
GGCCGGCTCCTCGGCCTCTTCGGCCGTGTCCCGGAGCTGCGCCACGCCGTGGAGAACGGG
CCGGCGGGCAAGTACTGGCAGAACACCCTGCTGCCGCTGGAGCGACGGGGGGTCTTCGAC
GCGGCGCTCGCGCACAAGCCGGCCTTCCCCTATGTCGTGGGCCTGTACCCGGGGCCGAGC
TGCATGTTCCGCTGCCACTTCTGCGTCCGGGTGACCGGTGCGCGGTACGACCCGTCGGCG
CTGGAGTCCGGCAACGCGATGTTCGCGTCCGTCATCGACGAGATCCCGGCCGGCAACCCG
TACGCCATGTACTTCTCGGGCGGTCTGGAGCCCCTCACCAACCCGGGCCTGGGCGCGCTC
AGCAGCCGTGCGGCGGCTCGCGGGCTGCGGCCGACCGTGTACACGAACTCGTTCGCGCTC
ACCGAGCGGACGCTGGACAGGCAGCCCGGGGTGTGGGACCTGCACGCGGTGCGCACCTCG
CTGTACGGCTTGAACGACGAGGAGTACGAGGAGACCACGGGCAAGCGCGCCGCCTTCGGA
AGGGTCCGCGCCAACCTGCGGCGCTTCCAGCAGCTGCGGTCCGAGCGGGAGAGCCCGATC
CGGCTCGGGCTCAGCTACATCGTGCTGCCCGGGCGCGTCCACCGGCTGCTCGACCTCGTC
GACTTCATCGCCGACCTGAACGAGGCCGCGCCGGACCGGCCGGTGGACTTCCTGAACGTG
CGCGAGGACTACAGCGGCCGGGAGGACGGCAGGCTGTTCGAGGCCGAACGCGCCGAACTC
CAGGAGGGGCTGCTCGCGTTCGAGGAGGCGGTGAGCCGGCGGACCCCCACGCTGAACATC
GACTACGGCTACGCGTTGCACAGCCTGAAGACCGGCGCGGACGCCGAGCTGCTCAGGATC
AGGCCCGGAACCATGCGCCGGTCCGCGCATCCCCAGGTGTCCGTACAGGTGGACCTGCTG
GGTGACGTGTACCTGTACCGGGAGGCGGGGTTCCCGGATCTCACCGGAGCGGACCGGTAC
GTCGCGGGCCGGGTGGGGCCGGGCACCTCCCTGACGGAGGTCGTCGAGCGGTTCGTGGAC
GACGGCCGTCTGATAGCGCCGCACGCCGGTGACGAGTACTTCATGGACGGGTTCGACCAG
GTGGTGGCGGCGCGGCTCAACCAGCTGGAGGCCGATGTCGTGGCCGGCTGGGAGGACGCG
CGCGGCTTCCTGAGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR016863 Reductase, EryCV, predicted (Family)
 [1-485]  PIRSF027982
PIRSF027982   Reductase_EryCV_prd
SignalP No significant hit
TMHMM No significant hit