close all open/close all

CDS information : Chalc_00070


close this sectionLocation

Organism
StrainNRRL 2737
Entry nameChalcomycin
Contig
Start / Stop / Direction10,271 / 7,761 / - [in whole cluster]
10,271 / 7,761 / - [in contig]
Locationcomplement(7761..10271) [in whole cluster]
complement(7761..10271) [in contig]
TypeCDS
Length2,511 bp (836 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.4 resistance
Productputative beta-glucosidase
Product (GenBank)putative beta-glucosidase
Gene
Gene (GenBank)chmR
EC number3.2.1.21
Keyword
  • extracellular reactivation
Note
Note (GenBank)
  • possible extracellular reactivator of chalcomycin; similar to EryBI, OleR, DesR, NbmF, ORF30 lankamycin cluster
Reference
ACC
PmId
[15561847] Chalcomycin biosynthesis gene cluster from Streptomyces bikiniensis: novel features of an unusual ketolide produced through expression of the chm polyketide synthase in Streptomyces fradiae. (Antimicrob Agents Chemother. , 2004)
Related Reference
ACC
Q9ZGH5
NITE
Pikro_00110
PmId
[9770448] A gene cluster for macrolide antibiotic biosynthesis in Streptomyces venezuelae: architecture of metabolic diversity. (Proc Natl Acad Sci U S A. , 1998)
[14674753] Beta-glucosylation as a part of self-resistance mechanism in methymycin/pikromycin producing strain Streptomyces venezuelae. (Biochemistry. , 2003)
ACC
O68843
PmId
[9680207] Two glycosyltransferases and a glycosidase are involved in oleandomycin modification during its biosynthesis by Streptomyces antibioticus. (Mol Microbiol. , 1998)

close this sectionSequence

selected fasta
>putative beta-glucosidase [putative beta-glucosidase]
MRTATSAERTSVSMLFGTTRTGRRIRRTVGSALAALCVGGLLTAPSAAGAPAAEPGTARV
RGLVAKMTLDEKISFVHWTTGPVGGPTMTGIGYLPGVPRLGIPELRTADGPVGIRLLGGT
ATAMPTPVALAATFDERLAEEYGTVLGREGRALGQDIVLGPMTNVIRVPHAGRNFETYSE
DPLLSSRMAAHEVRGIQNQGLMATVKHFAANNQEYQRETIDAVVDEQTLQEVELPAFRSA
VRAGAASVMCSYNKVNGAHACGNEHLLQEVLREQWDFRGWVVSDWLATHATGDITRGLDQ
ELGVELTLGQPVPESKYFSSALRAAVRDGSVPEATLDRSVVRILGQMERFGLLDGKATER
PQRDPEAGRAAARTIAENGGVLLRNERRTLPLTGEDATDIAVIGNSAKHPKVTGNGSAHV
IPDRATAPVDALARRAGEKARVVHEPGEDLVGVPVPESSLTPAFTSGKQLDPSGQGVFYE
GRLTVPADGDYKIAFTAVGGVANLQIAGQSAVLGTEAFGTVTTTMRLTRGTHAVTMNGWA
FEQTPLSVELSWVTPEAARDDFDRAVAAAAEARTAVVFAHDDSAEGVDRSSLSLPGRQDE
LIAAITKVNPRTIVVLNTGSSVLMPWLRETAAVLEMWYPGQEGAEATAALLFGDANPSGR
LTQTFPATETGHPMAGDPHRYPGVDGKETYSEGLDVGYRWYDRTGVAPLFPFGYGLSYTT
FAYSDLSVARTARGLEATVTVRNTGDRAGRETVQVYLGASPDTQAPQALRKLAGFTKVTL
RPGEQRRVTVPVDEQQLRYWDTAAGTWKPGTGRRAVHVGPSAAETSLTTSVTVPSR
selected fasta
>putative beta-glucosidase [putative beta-glucosidase]
ATGAGGACGGCAACCTCGGCAGAAAGGACGTCCGTCAGCATGCTGTTCGGCACGACGAGG
ACGGGTCGCCGCATCCGGCGCACCGTCGGATCCGCGCTCGCGGCCCTGTGCGTCGGCGGT
CTGCTCACCGCCCCCTCCGCCGCCGGTGCTCCGGCCGCCGAGCCCGGGACGGCGCGGGTG
CGCGGGCTGGTGGCGAAGATGACCCTCGACGAGAAGATCTCGTTCGTCCACTGGACCACC
GGGCCCGTGGGCGGGCCGACCATGACCGGCATCGGCTATCTGCCGGGCGTGCCCCGGCTC
GGCATCCCCGAGCTGCGCACCGCCGACGGCCCGGTCGGCATCCGTCTGCTCGGCGGTACC
GCCACCGCCATGCCCACCCCCGTGGCGCTCGCCGCCACCTTCGACGAACGCCTCGCCGAG
GAGTACGGCACCGTCCTGGGCCGGGAGGGACGGGCCCTCGGACAGGACATCGTCCTCGGT
CCCATGACCAACGTCATCCGGGTGCCGCACGCGGGGCGGAACTTCGAGACCTACAGCGAG
GATCCTCTGCTGTCGTCCCGGATGGCCGCCCACGAGGTCCGCGGCATCCAGAACCAGGGC
CTGATGGCCACGGTCAAGCACTTCGCCGCGAACAACCAGGAGTACCAGCGGGAGACCATC
GACGCCGTGGTCGACGAGCAGACGCTCCAGGAGGTGGAGCTGCCGGCCTTCCGCAGCGCC
GTGCGGGCGGGCGCCGCCTCGGTGATGTGCTCGTACAACAAGGTCAACGGCGCGCACGCA
TGCGGGAACGAGCACCTGTTGCAGGAGGTGCTGCGCGAACAGTGGGACTTCCGCGGCTGG
GTGGTGTCCGACTGGCTGGCGACCCACGCCACCGGCGACATCACCAGGGGCCTCGACCAG
GAACTGGGCGTCGAGCTGACCCTGGGGCAGCCGGTGCCGGAATCGAAGTACTTCTCCTCC
GCGCTCAGGGCCGCCGTGCGGGACGGCAGCGTCCCCGAGGCGACGCTCGATCGGTCCGTC
GTCCGCATCCTCGGCCAGATGGAGCGCTTCGGCCTGCTCGACGGCAAGGCGACCGAGCGC
CCGCAGCGTGATCCCGAGGCCGGCCGCGCGGCGGCCCGCACCATCGCCGAGAACGGCGGG
GTGCTGCTGCGCAACGAGCGCCGGACGCTGCCCCTGACCGGTGAGGACGCCACGGACATC
GCCGTCATCGGCAACAGCGCCAAGCACCCCAAGGTCACCGGCAACGGCAGCGCGCACGTC
ATACCCGACCGGGCGACCGCACCCGTCGACGCCCTCGCACGGCGCGCCGGCGAGAAGGCC
CGGGTCGTCCACGAGCCCGGTGAGGACCTGGTCGGCGTGCCCGTGCCCGAAAGCTCGCTC
ACCCCCGCCTTCACGAGCGGGAAGCAACTGGATCCCAGCGGCCAGGGCGTCTTCTACGAG
GGTCGGCTCACCGTCCCCGCCGACGGCGACTACAAGATCGCCTTCACCGCCGTCGGCGGG
GTCGCCAACCTGCAGATCGCGGGGCAGTCCGCTGTCCTCGGCACCGAGGCGTTCGGCACC
GTCACCACCACGATGCGGCTGACCCGCGGCACCCACGCGGTGACCATGAACGGCTGGGCC
TTCGAACAGACCCCGCTGTCGGTGGAGCTGAGCTGGGTCACTCCCGAGGCTGCCCGGGAC
GACTTCGACCGCGCCGTCGCGGCGGCGGCCGAGGCCCGCACCGCCGTCGTCTTCGCCCAC
GACGACAGTGCCGAGGGCGTGGACCGGTCCTCGCTGTCCCTGCCCGGCCGACAGGACGAG
CTGATCGCGGCGATCACCAAGGTCAACCCCCGCACGATCGTCGTCCTCAACACCGGTTCC
TCGGTGCTCATGCCCTGGCTGCGTGAGACGGCCGCCGTACTGGAGATGTGGTACCCGGGG
CAGGAGGGCGCGGAGGCCACCGCTGCCCTGCTGTTCGGCGACGCGAATCCCAGCGGCCGG
CTGACCCAGACCTTCCCGGCCACCGAGACCGGCCATCCCATGGCCGGTGACCCGCACCGC
TACCCGGGTGTCGACGGCAAGGAGACCTATTCCGAGGGACTGGATGTCGGCTACCGGTGG
TACGACCGGACCGGCGTGGCCCCGCTCTTCCCGTTCGGGTACGGCCTGTCGTACACCACC
TTCGCCTACAGCGACCTGTCCGTGGCGCGCACCGCCCGGGGGCTGGAGGCCACGGTCACC
GTCCGCAACACCGGTGACCGGGCGGGCAGGGAGACCGTCCAGGTCTACCTCGGGGCAAGT
CCGGACACCCAGGCCCCCCAGGCGCTGCGCAAACTCGCCGGATTCACCAAGGTCACCCTC
CGGCCGGGAGAACAGCGGCGGGTCACCGTCCCCGTCGACGAGCAGCAACTGCGCTACTGG
GACACCGCCGCCGGCACGTGGAAGCCGGGCACCGGCAGGAGGGCCGTACACGTGGGCCCG
TCCGCGGCCGAGACGTCCCTGACCACATCCGTCACGGTGCCGTCCCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001764 Glycoside hydrolase, family 3, N-terminal (Domain)
 [99-115]  2.19999900980708e-32 PR00133 [124-143]  2.19999900980708e-32 PR00133 [170-186]  2.19999900980708e-32 PR00133 [201-217]  2.19999900980708e-32 PR00133 [270-288]  2.19999900980708e-32 PR00133
PR00133   GLHYDRLASE3
 [55-359]  9.60000000000003e-104 G3DSA:3.20.20.300
G3DSA:3.20.20.300   Glyco_hydro_3_N
 [68-344]  9.80000000000012e-86 PF00933
PF00933   Glyco_hydro_3
IPR002772 Glycoside hydrolase family 3 C-terminal domain (Domain)
 [380-721]  4.30000170645869e-50 SSF52279
SSF52279   Glyco_hydro_3_C
 [367-449]  4.70000000000003e-62 G3DSA:3.40.50.1700 [564-721]  4.70000000000003e-62 G3DSA:3.40.50.1700
G3DSA:3.40.50.1700   G3DSA:3.40.50.1700
 [381-698]  3.40000000000004e-59 PF01915
PF01915   Glyco_hydro_3_C
IPR017853 Glycoside hydrolase, superfamily (Domain)
 [45-379]  2.7000136937899e-93 SSF51445
SSF51445   Glyco_hydro_cat
SignalP
 [1-52]  1 Signal
Bacteria, Gram-positive   
 [1-49]  1 Signal
Bacteria, Gram-negative   
 [1-49]  0.973 Signal
Eukaryota   
TMHMM
 [29-51]  Transmembrane (i-o)
Transmembrane 1