close all open/close all

CDS information : Chalc_00080


close this sectionLocation

Organism
StrainNRRL 2737
Entry nameChalcomycin
Contig
Start / Stop / Direction11,511 / 10,306 / - [in whole cluster]
11,511 / 10,306 / - [in contig]
Locationcomplement(10306..11511) [in whole cluster]
complement(10306..11511) [in contig]
TypeCDS
Length1,206 bp (401 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative epoxidase
putative cytochrome P450
Product (GenBank)P450
Gene
Gene (GenBank)chmPII
EC number
Keyword
Note
Note (GenBank)
  • putative macrolide C12,C13-epoxidase; similar to MycG, LnmZ
Reference
ACC
PmId
[15561847] Chalcomycin biosynthesis gene cluster from Streptomyces bikiniensis: novel features of an unusual ketolide produced through expression of the chm polyketide synthase in Streptomyces fradiae. (Antimicrob Agents Chemother. , 2004)
Related Reference
ACC
Q331R6
PmId
[21069297] Identification and characterization of gerPI and gerPII involved in epoxidation and hydroxylation of dihydrochalcolactone in Streptomyces species KCTC 0041BP. (Arch Microbiol. , 2011)

close this sectionSequence

selected fasta
>putative epoxidase [P450]
MGLPLTSTKTAPVSYPFGRPEGLDLDEAYEQARKSEGLLWVHMPYGEPGWLVSRYDDARF
VLGDRRFSHAAEAENDAPRMRELRTPNGIIGMDAPDHTRLRGLVTKAFTPRRVEAMRPHV
RRMTASLLRDMTALGSPVDLVDHYAVPLPVAVICGLLGVPEEDRDLFRGWCEIAMSTSSL
TAEDHVRLAGELTGYLADLITARRAAPRDDLVSALVEARDAQGRLSQEELVDLIVFLLFA
GHETTASQISNFVLVLLEQPDQLALLRDRPDLLDNAVEELTRFVPLGSQAGFPRYATEDV
EVGGTLVRAGDPVLVQMNAANRDALRFRSPGVLDITRDDAGRHLGYGHGPHHCLGASLAR
LELQEALRTLLDELPGLHLAQPVEWKTEMVVRGPRTMLVGW
selected fasta
>putative epoxidase [P450]
ATGGGGCTCCCCTTGACCAGCACGAAGACCGCACCCGTCTCCTATCCCTTCGGCCGCCCG
GAGGGACTGGACCTGGACGAGGCGTACGAGCAGGCGCGGAAGAGCGAAGGACTCCTCTGG
GTCCACATGCCGTACGGGGAGCCGGGCTGGCTCGTCTCCCGTTACGACGACGCGCGTTTC
GTCCTCGGCGACCGGCGGTTCAGCCACGCCGCGGAGGCGGAGAACGACGCGCCGCGCATG
CGGGAGCTGCGGACGCCCAACGGCATCATCGGCATGGACGCGCCGGACCACACCAGGCTG
CGCGGGCTGGTCACCAAGGCGTTCACCCCGCGCCGCGTGGAGGCCATGCGGCCGCACGTC
CGAAGGATGACGGCGTCGCTGCTCCGGGACATGACGGCGCTCGGATCGCCCGTCGACCTC
GTGGACCACTACGCCGTCCCCCTTCCCGTGGCGGTCATCTGCGGCCTGCTGGGCGTGCCC
GAGGAGGACCGTGACCTGTTCCGCGGCTGGTGCGAGATAGCGATGTCCACCAGCTCGCTC
ACCGCCGAGGACCATGTGCGGCTGGCCGGCGAGCTGACCGGCTATCTGGCGGACCTGATC
ACGGCCCGCCGCGCCGCGCCGCGAGACGATCTCGTCTCGGCGCTCGTCGAGGCCCGTGAC
GCCCAGGGCCGGCTGTCGCAGGAGGAGTTGGTCGACCTGATCGTCTTCCTCCTGTTCGCC
GGGCACGAGACCACGGCCAGCCAGATCAGCAACTTCGTCCTGGTCCTGCTCGAACAGCCG
GACCAGCTGGCCCTCCTCCGGGACCGTCCTGACCTGCTGGACAACGCGGTGGAAGAGCTG
ACGCGGTTCGTTCCGCTCGGCAGCCAGGCGGGATTCCCGCGCTACGCCACCGAGGACGTC
GAGGTGGGCGGGACGCTGGTGCGGGCGGGGGATCCGGTGCTGGTCCAGATGAACGCCGCC
AACCGGGACGCCCTGCGCTTCCGCTCGCCCGGCGTGCTCGACATCACCCGCGACGACGCC
GGCCGGCACCTGGGGTACGGACACGGTCCGCATCACTGCCTCGGCGCGTCCCTCGCGCGG
CTGGAGCTCCAGGAGGCGCTGCGGACCCTGCTCGACGAACTCCCCGGGCTGCACCTCGCC
CAGCCCGTCGAGTGGAAGACGGAGATGGTGGTGCGGGGCCCGCGCACGATGCTCGTGGGC
TGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [240-257]  3.19999899046351e-07 PR00385 [275-286]  3.19999899046351e-07 PR00385 [344-353]  3.19999899046351e-07 PR00385 [353-364]  3.19999899046351e-07 PR00385
PR00385   P450
 [17-401]  3.49999999999995e-109 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [9-401]  3.99998544139406e-97 SSF48264
SSF48264   Cytochrome_P450
 [194-372]  2.8e-19 PF00067
PF00067   p450
IPR002397 Cytochrome P450, B-class (Family)
 [92-103]  2.19999900980707e-58 PR00359 [139-155]  2.19999900980707e-58 PR00359 [156-171]  2.19999900980707e-58 PR00359 [194-216]  2.19999900980707e-58 PR00359 [275-286]  2.19999900980707e-58 PR00359 [294-321]  2.19999900980707e-58 PR00359 [322-337]  2.19999900980707e-58 PR00359 [344-353]  2.19999900980707e-58 PR00359 [353-364]  2.19999900980707e-58 PR00359
PR00359   BP450
SignalP No significant hit
TMHMM No significant hit