close all open/close all

CDS information : Chalc_00090


close this sectionLocation

Organism
StrainNRRL 2737
Entry nameChalcomycin
Contig
Start / Stop / Direction12,772 / 11,549 / - [in whole cluster]
12,772 / 11,549 / - [in contig]
Locationcomplement(11549..12772) [in whole cluster]
complement(11549..12772) [in contig]
TypeCDS
Length1,224 bp (407 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative cytochrome P450
Product (GenBank)P450
Gene
Gene (GenBank)chmPI
EC number
Keyword
  • C-8 hydroxylate
Note
Note (GenBank)
  • putative macrolide C8-hydroxylase; similar to OleP
Reference
ACC
PmId
[15561847] Chalcomycin biosynthesis gene cluster from Streptomyces bikiniensis: novel features of an unusual ketolide produced through expression of the chm polyketide synthase in Streptomyces fradiae. (Antimicrob Agents Chemother. , 2004)
Related Reference
ACC
Q331R5
PmId
[21069297] Identification and characterization of gerPI and gerPII involved in epoxidation and hydroxylation of dihydrochalcolactone in Streptomyces species KCTC 0041BP. (Arch Microbiol. , 2011)

close this sectionSequence

selected fasta
>putative cytochrome P450 [P450]
MTSSCPVHRTRPYPFSPPEGIALDPLYSRLREHEPVSRIRMPYGGEAWLLTRHADVRAVL
GDPRFSMEAGAGRDVPRPTEYPLPAGGLISMDPPGHTRLRRLAGKAFTARRVEELRPRVS
RFTDELLDGMVARDEPSGEVMEDLALPVSISVICGLLGVSYDDRHLFRDFSEALVSSSLG
PAEVQRATEDFSAYMADLVADRRARPTDDFLSTMVQARDEGDRLSEAELLMMGSGLLISG
YETTATQIGNFVLLLLDDRRLYERLVTEPDLVPSAVEELLRFTPLSTLDGFARIALEDVE
IGGTLIRAGEAVITSIASANLDDTAFPGAASLDLARAQNPHLGFGHGAHYCMGAPLARLE
LQVVLSTLVERLPELRLSVPASELRWRAGSLLRTPEAVPVTWGGSAA
selected fasta
>putative cytochrome P450 [P450]
ATGACGTCTAGCTGTCCGGTCCACCGGACTCGCCCGTACCCCTTCTCCCCGCCCGAGGGC
ATCGCGCTGGATCCGCTCTACAGCCGTCTGCGGGAGCACGAGCCCGTGTCCCGGATCCGC
ATGCCGTACGGCGGTGAGGCCTGGCTGCTGACCCGACACGCCGACGTGAGGGCGGTCCTG
GGAGACCCGCGGTTCAGCATGGAGGCCGGGGCCGGACGTGACGTGCCCCGGCCCACCGAG
TACCCGCTGCCCGCCGGCGGTCTCATCTCCATGGACCCGCCCGGACACACCAGGCTCCGG
CGGCTCGCCGGGAAGGCGTTCACCGCCCGCCGGGTGGAGGAACTGCGCCCGCGGGTCTCA
CGGTTCACCGATGAACTGCTCGACGGCATGGTCGCGCGCGACGAGCCGTCCGGCGAGGTC
ATGGAAGACCTGGCGCTGCCCGTGTCGATCTCCGTGATCTGCGGACTGCTGGGCGTCTCC
TACGACGACCGCCACCTCTTCCGGGACTTCTCCGAGGCGCTGGTGTCCTCCTCCCTGGGG
CCCGCCGAAGTGCAGCGGGCGACCGAGGACTTCTCCGCCTACATGGCCGACCTCGTGGCC
GATCGCCGCGCCCGGCCCACCGACGACTTCCTCAGCACCATGGTCCAGGCCCGTGACGAA
GGCGACCGGCTCTCCGAGGCCGAGCTCCTCATGATGGGCTCCGGCCTGCTGATCAGCGGA
TACGAGACGACCGCCACCCAGATCGGCAATTTCGTCCTCCTCCTGCTCGACGACCGCCGC
CTCTACGAGCGCCTGGTGACCGAACCTGACCTGGTTCCCTCCGCCGTCGAGGAGCTGCTG
CGCTTCACCCCGCTGAGCACCCTGGACGGGTTCGCCCGCATCGCCTTGGAGGACGTCGAG
ATCGGCGGCACGCTCATCCGCGCGGGCGAGGCGGTCATCACCTCGATCGCGTCCGCGAAC
CTCGACGACACGGCGTTTCCCGGTGCCGCCTCCCTCGACCTGGCCCGTGCCCAGAACCCG
CACCTCGGCTTCGGTCACGGCGCCCACTACTGCATGGGCGCCCCCCTGGCCCGGCTCGAA
CTGCAGGTCGTGCTGAGCACCCTGGTCGAGCGCCTGCCGGAGCTCCGGCTGTCCGTCCCC
GCGAGTGAGCTTCGCTGGCGGGCCGGCTCCCTCCTGCGCACCCCCGAGGCGGTCCCCGTC
ACCTGGGGCGGCTCGGCCGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [239-256]  1e-07 PR00385 [274-285]  1e-07 PR00385 [342-351]  1e-07 PR00385 [351-362]  1e-07 PR00385
PR00385   P450
 [47-371]  8.00000000000001e-22 PF00067
PF00067   p450
 [16-402]  3.79999999999991e-111 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [6-402]  4.20003460493095e-95 SSF48264
SSF48264   Cytochrome_P450
IPR002397 Cytochrome P450, B-class (Family)
 [91-102]  2.50000909916183e-53 PR00359 [139-155]  2.50000909916183e-53 PR00359 [156-171]  2.50000909916183e-53 PR00359 [193-215]  2.50000909916183e-53 PR00359 [274-285]  2.50000909916183e-53 PR00359 [293-320]  2.50000909916183e-53 PR00359 [321-336]  2.50000909916183e-53 PR00359 [342-351]  2.50000909916183e-53 PR00359 [351-362]  2.50000909916183e-53 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [344-353]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit