close all open/close all

CDS information : Chalc_00100


close this sectionLocation

Organism
StrainNRRL 2737
Entry nameChalcomycin
Contig
Start / Stop / Direction13,610 / 12,762 / - [in whole cluster]
13,610 / 12,762 / - [in contig]
Locationcomplement(12762..13610) [in whole cluster]
complement(12762..13610) [in contig]
TypeCDS
Length849 bp (282 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative type II thioesterase
Product (GenBank)putative thioesterase TEII family
Gene
Gene (GenBank)chmI
EC number
Keyword
  • type II thioesterase
Note
Note (GenBank)
  • similar to TylO, Streptomyces avermitilis SAV407 PteH
Reference
ACC
PmId
[15561847] Chalcomycin biosynthesis gene cluster from Streptomyces bikiniensis: novel features of an unusual ketolide produced through expression of the chm polyketide synthase in Streptomyces fradiae. (Antimicrob Agents Chemother. , 2004)
Related Reference
ACC
Q9ZGI1
NITE
Pikro_00070
PmId
[9770448] A gene cluster for macrolide antibiotic biosynthesis in Streptomyces venezuelae: architecture of metabolic diversity. (Proc Natl Acad Sci U S A. , 1998)
[10421766] Elucidating the mechanism of chain termination switching in the picromycin/methymycin polyketide synthase. (Chem Biol. , 1999)
[10676969] Alternative modular polyketide synthase expression controls macrolactone structure. (Nature. , 2000)
[10713461] Genetic architecture of the polyketide synthases for methymycin and pikromycin series macrolides. (Gene. , 2000)
[11223265] The Streptomyces venezuelae pikAV gene contains a transcription unit essential for expression of enzymes involved in glycosylation of narbonolide and 10-deoxymethynolide. (Gene. , 2001)
[12368286] Biochemical evidence for an editing role of thioesterase II in the biosynthesis of the polyketide pikromycin. (J Biol Chem. , 2002)
ACC
Q9LAS9
PmId
[12055297] Type II thioesterase from Streptomyces coelicolor A3(2). (Microbiology. , 2002)

close this sectionSequence

selected fasta
>putative type II thioesterase [putative thioesterase TEII family]
MNEGPATTAPGSTNAGDLWLRRYRPVADPALRLVCLPHAGGSASAFLPFTCLLPDRVEVL
AVQYPGRQDRRLEPFVDSVDALVTHVAGALGPWLDRPVALFGHSLGSLVAFETARRLAEQ
APESRLAHLFVSGRVAPTVAHRTTAHLLSDDRLVAKLAELQGTDPRVLADEEVLRMALPA
IRNDYRAAATYTWRPGAPLACPITVLTGSADPHVPTDGALAWHGLTTGETAFRSFPGGHF
YLTEQAEAVCRTIRTATGLAVGRPHPSSSAAAPYDRESVHDV
selected fasta
>putative type II thioesterase [putative thioesterase TEII family]
ATGAACGAGGGGCCCGCCACGACGGCGCCCGGCTCCACCAACGCCGGCGACCTCTGGCTG
CGCCGCTACCGGCCCGTCGCCGACCCCGCGCTCCGGCTCGTGTGCCTTCCGCACGCCGGC
GGCAGCGCCAGCGCCTTCCTCCCCTTCACCTGTCTGCTGCCGGACCGGGTCGAGGTGCTC
GCCGTCCAGTATCCCGGGCGGCAGGACCGGCGGCTGGAGCCGTTCGTGGACTCCGTCGAC
GCTCTGGTGACGCACGTCGCCGGAGCGCTCGGCCCCTGGCTGGACCGGCCGGTGGCGCTC
TTCGGTCACAGCCTGGGGTCGCTGGTGGCCTTCGAGACCGCCCGCCGGCTCGCGGAACAG
GCGCCGGAGAGCAGGCTGGCGCATCTGTTCGTCTCCGGCCGCGTCGCCCCGACCGTCGCC
CACCGGACCACCGCGCACCTGCTGAGCGACGACCGGCTGGTCGCCAAGCTGGCCGAACTG
CAAGGCACCGACCCCCGGGTGCTGGCCGACGAGGAGGTCCTGCGGATGGCCCTGCCGGCG
ATCCGCAACGACTACCGGGCCGCCGCCACCTACACGTGGCGTCCGGGAGCTCCGCTCGCC
TGCCCGATCACCGTGCTGACGGGAAGCGCGGATCCGCACGTCCCCACCGACGGAGCCCTG
GCCTGGCACGGGCTGACCACCGGGGAGACGGCGTTCCGTTCCTTCCCCGGAGGCCACTTC
TACCTCACCGAGCAGGCCGAAGCGGTGTGCCGGACGATCCGGACGGCGACCGGGCTCGCC
GTCGGCCGCCCGCACCCTTCGAGCTCTGCCGCCGCCCCGTACGACCGAGAGAGTGTCCAT
GACGTCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [32-255]  4.39999999999997e-53 PF00975
PF00975   Thioesterase
SignalP
 [1-45]  0.17 Signal
Bacteria, Gram-negative   
TMHMM No significant hit