close all open/close all

CDS information : Chalc_00110


close this sectionLocation

Organism
StrainNRRL 2737
Entry nameChalcomycin
Contig
Start / Stop / Direction14,602 / 13,631 / - [in whole cluster]
14,602 / 13,631 / - [in contig]
Locationcomplement(13631..14602) [in whole cluster]
complement(13631..14602) [in contig]
TypeCDS
Length972 bp (323 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative dTDP-glucose 4,6-dehydratase
Product (GenBank)putative TDP-glucose 4,6-dehydratase
Gene
Gene (GenBank)chmAII
EC number4.2.1.46
Keyword
  • 6-deoxy-D-allose (D-mycinose)
  • D-chalcose
Note
Note (GenBank)
  • similar to Streptomyces avermitilis SAV946 AveBII, ORF4 of the tylosin cluster
Reference
ACC
PmId
[15561847] Chalcomycin biosynthesis gene cluster from Streptomyces bikiniensis: novel features of an unusual ketolide produced through expression of the chm polyketide synthase in Streptomyces fradiae. (Antimicrob Agents Chemother. , 2004)
Related Reference
ACC
Q54116
PmId
[7883182] Cloning of the genes encoding thymidine diphosphoglucose 4,6-dehydratase and thymidine diphospho-4-keto-6-deoxyglucose 3,5-epimerase from the erythromycin-producing Saccharopolyspora erythraea. (Gene. , 1995)

close this sectionSequence

selected fasta
>putative dTDP-glucose 4,6-dehydratase [putative TDP-glucose 4,6-dehydratase]
MRVLVTGAAGFIGSHFVRQLLSGSYPELAGAHVLSLDKLTYAGNTENLAEVAGHPRHTFL
HGDICDPPTVAQALRGTDLVVHFAAESHVDRSITDSAAFVTTNVLGTQTLLRSALEAGVS
RFVHVSTDEVYGSIPEGSSTEADPLDPNSPYAASKASSDLLALAFHRTHGLDVRVTRCSN
NYGPHQHPEKVVPLFVTHLLEGLRLPLYGDGLHRRDWLHVDDHCRGIAMVAARGRAGEVY
NIGGGTELSNVDLTRRLLGVFGADWSVVDRVPDRAAHDRRYCVDTRKITEELGWAPRVAF
DRGLAETVDWYRDNGTWWKALTP
selected fasta
>putative dTDP-glucose 4,6-dehydratase [putative TDP-glucose 4,6-dehydratase]
ATGCGCGTCCTGGTGACCGGGGCAGCGGGCTTCATCGGCTCGCACTTCGTCAGACAGCTC
CTGTCGGGCTCCTATCCGGAGCTGGCCGGCGCCCACGTCCTCTCGCTGGACAAGCTCACG
TACGCCGGGAACACCGAGAACCTCGCCGAGGTCGCCGGCCACCCCCGTCACACCTTCCTG
CACGGCGACATCTGCGACCCGCCCACGGTGGCCCAGGCCCTGCGCGGCACCGACCTGGTG
GTGCACTTCGCCGCCGAGTCGCACGTGGACCGCTCGATCACGGACTCCGCCGCCTTCGTC
ACCACCAACGTGCTGGGGACGCAGACCCTGCTGCGGTCGGCGCTCGAAGCGGGCGTCAGC
CGCTTCGTCCACGTCTCCACCGACGAGGTGTACGGATCGATCCCCGAGGGCTCCTCCACC
GAGGCCGATCCGCTGGACCCGAACTCCCCCTACGCGGCGTCCAAGGCCTCCTCCGACCTC
CTGGCGCTCGCCTTCCACCGTACCCACGGCCTCGACGTCCGGGTGACGCGCTGCTCCAAC
AACTACGGCCCCCACCAGCACCCCGAGAAGGTCGTCCCGCTCTTCGTGACCCATCTGCTG
GAGGGCCTGCGCCTTCCCCTGTACGGGGACGGCCTCCACCGGCGCGACTGGCTGCACGTG
GACGACCACTGCCGGGGCATCGCCATGGTCGCCGCCCGGGGGCGGGCCGGAGAGGTGTAC
AACATCGGCGGCGGGACGGAACTGTCCAACGTCGACCTCACCCGTCGTCTTCTCGGCGTC
TTCGGTGCCGACTGGTCCGTGGTGGACCGGGTGCCGGACCGGGCCGCGCACGACCGTCGC
TACTGCGTGGACACCCGGAAGATCACCGAGGAGCTGGGATGGGCTCCCCGCGTCGCCTTC
GATCGCGGGCTCGCGGAGACCGTCGACTGGTACCGGGACAACGGCACGTGGTGGAAGGCG
CTGACACCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [3-243]  5.69999999999998e-68 PF01370
PF01370   Epimerase
IPR005888 dTDP-glucose 4,6-dehydratase (Family)
 [2-321]  4.30000000000003e-126 TIGR01181
TIGR01181   DTDP_gluc_dehyt
IPR016040 NAD(P)-binding domain (Domain)
 [1-179]  1.20000000000001e-65 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-22]  0.753 Signal
Eukaryota   
TMHMM No significant hit